Gene Information

Name : EcDH1_1682 (EcDH1_1682)
Accession : YP_006091633.1
Strain : Escherichia coli DH1
Genome accession: NC_017625
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1839121 - 1839903 bp
Length : 783 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: sbc:SbBS512_E0914 heavy metal response regulator

DNA sequence :
ATGAGTTTTGAGGATAGCGAAAAAGCGTCCAGGGTAACCTTACAGCAGCATTACAATTTTGTAATGAACCAGGCTGTTTC
TATAACATATGATTTATGGCATATTATTTTCATGAAGATTCTACTTATTGAAGATAATCAAAGGACCCAGGAATGGGTAA
CGCAGGGGCTTTCCGAAGCGGGTTATGTCATCGATGCCGTTTCTGATGGCAGAGATGGGCTTTATCTTGCGCTGAAGGAT
GATTATGCATTGATCATTCTGGATATTATGCTTCCGGGTATGGATGGCTGGCAGATCTTACAAACGTTAAGAACAGCAAA
GCAAACCCCTGTTATTTGCCTTACTGCAAGGGATTCTGTCGATGACAGAGTCAGAGGGCTGGACAGTGGGGCAAATGATT
ATCTGGTAAAACCTTTTTCATTTTCTGAGTTGCTGGCAAGGGTTCGGGCACAATTAAGGCAACATCACGCTTTGAATTCA
ACATTAGAAATCAGCGGCTTAAGAATGGACTCTGTTAGTCATAGTGTGAGCAGGGACAATATCAGTATTACACTGACGCG
CAAGGAGTTTCAGTTACTTTGGCTACTGGCCTCCAGAGCTGGCGAAATTATACCCAGAACGGTTATTGCGAGTGAAATTT
GGGGAATCAACTTTGATAGTGATACCAATACGGTGGACGTCGCCATTCGCAGGCTCCGCGCAAAAGTTGATGATCCTTTT
CCTGAAAAGCTAATTGCCACAATCCGGGGGATGGGCTATTCATTCGTAGCGGTAAAAAAATAA

Protein sequence :
MSFEDSEKASRVTLQQHYNFVMNQAVSITYDLWHIIFMKILLIEDNQRTQEWVTQGLSEAGYVIDAVSDGRDGLYLALKD
DYALIILDIMLPGMDGWQILQTLRTAKQTPVICLTARDSVDDRVRGLDSGANDYLVKPFSFSELLARVRAQLRQHHALNS
TLEISGLRMDSVSHSVSRDNISITLTRKEFQLLWLLASRAGEIIPRTVIASEIWGINFDSDTNTVDVAIRRLRAKVDDPF
PEKLIATIRGMGYSFVAVKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-80 76
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-82 74

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EcDH1_1682 YP_006091633.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 1e-58 57
EcDH1_1682 YP_006091633.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 6e-56 56
EcDH1_1682 YP_006091633.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 3e-54 54
EcDH1_1682 YP_006091633.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 6e-52 53
EcDH1_1682 YP_006091633.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 2e-55 52
EcDH1_1682 YP_006091633.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 1e-48 52
EcDH1_1682 YP_006091633.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 8e-50 49
EcDH1_1682 YP_006091633.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-38 42
EcDH1_1682 YP_006091633.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-38 42
EcDH1_1682 YP_006091633.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-38 42
EcDH1_1682 YP_006091633.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-38 42
EcDH1_1682 YP_006091633.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-38 42
EcDH1_1682 YP_006091633.1 two component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-38 42
EcDH1_1682 YP_006091633.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-38 42
EcDH1_1682 YP_006091633.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-38 42
EcDH1_1682 YP_006091633.1 two component heavy metal response transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-33 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EcDH1_1682 YP_006091633.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 1e-80 76