Gene Information

Name : irlR (BDGL_001714)
Accession : YP_004995982.1
Strain : Acinetobacter calcoaceticus PHEA-2
Genome accession: NC_016603
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1839306 - 1839977 bp
Length : 672 bp
Strand : -
Note : -

DNA sequence :
ATGCGTATCCTTATTATTGAAGACGAGATCAAGATCGCCACTTATTTGGTTAAAGGATTAAAAGAGTCTGGATATCAAGC
GGAGTGCGTTCACTTAGGGCTGCAAGGTTTGGAAATGCTAAAGAGAGATCAATATGATTTGCTTATTCTTGATGTCATGT
TGCCAGACATAGACGGCTGGAGCGTATTACAAGTCCTACGCCAGTTTTCAAGAATTCCGGTGATTTTCTTAACGGCGAAA
GATCAGGTGATGGATAGAGTGAAAGGTTTGGAGTTGGGCGCAGATGATTACTTGGCTAAACCTTTTTCCTATATTGAACT
GTTGGCACGCATTAAAAGTCTGTTAAGACGACAGCAATATCTGCAAGAAAACGAACTGTCTATTAGTGATCTAAAAATGG
ATGTGGTCGGCCATAAAGTATGGCGTAACGGAAACTTAATTGAACTGAGTAAAACCGAATTTAATTTGTTGCGTTATTTA
TTACTCAACAAAGAGCAAATTGTGACACGCAGACAAATTGGTTCCGAAGTTTGGAATATTAACTTTGACACTGATACAAA
CTTTATTGATGTTGCGGTACGCCGTTTACGAAGCAAAATTGATGAGGGATATGAATTAAAACTTATTCATACCATACGTG
GCTTGGGCTATAAAATTTCGGTTAGCTTATGA

Protein sequence :
MRILIIEDEIKIATYLVKGLKESGYQAECVHLGLQGLEMLKRDQYDLLILDVMLPDIDGWSVLQVLRQFSRIPVIFLTAK
DQVMDRVKGLELGADDYLAKPFSYIELLARIKSLLRRQQYLQENELSISDLKMDVVGHKVWRNGNLIELSKTEFNLLRYL
LLNKEQIVTRRQIGSEVWNINFDTDTNFIDVAVRRLRSKIDEGYELKLIHTIRGLGYKISVSL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-49 51
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-48 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR YP_004995982.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 1e-51 54
irlR YP_004995982.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 7e-57 54
irlR YP_004995982.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 1e-56 53
irlR YP_004995982.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 1e-53 50
irlR YP_004995982.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 2e-49 50
irlR YP_004995982.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 2e-54 49
irlR YP_004995982.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 1e-50 47
irlR YP_004995982.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 6e-34 44
irlR YP_004995982.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 6e-34 44
irlR YP_004995982.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 6e-34 44
irlR YP_004995982.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 6e-34 44
irlR YP_004995982.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 6e-34 44
irlR YP_004995982.1 two component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 6e-34 44
irlR YP_004995982.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 6e-34 44
irlR YP_004995982.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 6e-34 44
irlR YP_004995982.1 two component heavy metal response transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 9e-29 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
irlR YP_004995982.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 6e-50 51
irlR YP_004995982.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 8e-37 43