Gene Information

Name : SSPA1630 (SSPA1630)
Accession : YP_002142470.1
Strain : Salmonella enterica AKU12601
Genome accession: NC_011147
Putative virulence/resistance : Virulence
Product : transcriptional regulatory protein YedW
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1809190 - 1809870 bp
Length : 681 bp
Strand : +
Note : induced by CusR in the presence of copper; YedW induces the expression of the upstream gene yedV (encoding a sensor kinase) as well as yedW; yedVW is one of four copper regulons found in E. coli; part of the copper homeostasis mechanism; confers resistanc

DNA sequence :
ATGAAGATTTTATTGATTGAAGATAACCAGAAAACCATTGAGTGGGTACGTCAGGGACTCACGGAGGCAGGCTATATGGT
TGATTATGCCTGTGATGGACGAGACGGATTACACCTGGCCCTTCAGGAACATTATTCATTGATTATTCTTGATATTATGC
TGCCGGGGCTTGATGGATGGCAGGTTTTACGCGCGTTACGCACTGCGCATCAGTCCCCTGTTATTTGCCTGACGGCGCGC
GACTCGGTTGAGGATCGCGTCAAAGGTCTTGAGGCGGGCGCTAATGATTACCTTGTTAAGCCTTTTTCCTTCGCCGAACT
GCTGGCCCGGGTGAGAGCTCAACTCAGACAGCACGTCCCGGTCTTTACCCGACTGACGATCAATGGTCTGGACATGGATG
CCACAAAGCAATCGGTGTCACGAAATGGCAAACCGATTTCCCTGACCCGCAAAGAATTCCTGCTCCTCTGGTTACTGGCG
TCCCGGGCAGGAGAAATCGTGCCCCGAACCGCGATCGCCAGCGAAGTTTGGGGAATTAACTTTGATAGTGAAACCAACAC
CGTTGATGTCGCGATTCGTCGGCTGCGCGCCAAAGTAGACGATCCATTTGAAAAGAAGCTCATTATGACCGTCCGGGGGA
TGGGTTACCGATTACAGGCGGAAACGTCGCAGAATGGTTAA

Protein sequence :
MKILLIEDNQKTIEWVRQGLTEAGYMVDYACDGRDGLHLALQEHYSLIILDIMLPGLDGWQVLRALRTAHQSPVICLTAR
DSVEDRVKGLEAGANDYLVKPFSFAELLARVRAQLRQHVPVFTRLTINGLDMDATKQSVSRNGKPISLTRKEFLLLWLLA
SRAGEIVPRTAIASEVWGINFDSETNTVDVAIRRLRAKVDDPFEKKLIMTVRGMGYRLQAETSQNG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-103 99
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-102 98

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW BAC0083 Protein 5e-56 58
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW BAC0197 Protein 4e-59 58
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW BAC0125 Protein 2e-59 56
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW BAC0638 Protein 2e-52 56
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW BAC0308 Protein 2e-54 55
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW BAC0111 Protein 1e-56 53
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW BAC0347 Protein 6e-50 52
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW NC_007793.3914065.p0 Protein 1e-39 45
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW NC_007622.3794948.p0 Protein 1e-39 45
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW NC_002951.3238224.p0 Protein 1e-39 45
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW NC_002952.2859858.p0 Protein 1e-39 45
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW NC_013450.8614146.p0 Protein 1e-39 45
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW NC_010079.5776364.p0 Protein 1e-39 45
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW NC_003923.1003417.p0 Protein 1e-39 45
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW NC_002758.1121390.p0 Protein 1e-39 45
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW AE015929.1.gene1106. Protein 1e-33 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW VFG0596 Protein 2e-103 99
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW VFG0473 Protein 2e-29 42
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW VFG1389 Protein 4e-32 42
SSPA1630 YP_002142470.1 transcriptional regulatory protein YedW VFG1390 Protein 1e-37 41