Gene Information

Name : Q7A_1812 (Q7A_1812)
Accession : YP_006296275.1
Strain : Methylophaga sp. JAM1
Genome accession: NC_017857
Putative virulence/resistance : Virulence
Product : heavy metal response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1823618 - 1824310 bp
Length : 693 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; TIGRFAM: heavy metal response regulator

DNA sequence :
ATGCGATTATTATTAGTGGAAGATGAGGTAAAAACAGGCGACTACTTACAAAAAGGACTAAGCGAGGCCGGGTTTCAGGT
CAATCTTGTTCGAAATGGCCTAGATGGTCATCATTTGGCAATGACAGAAGCGTTTGATTTGATCGTTCTGGATGTTATGT
TGCCGGATGTTGACGGGTGGCGGATCTTGCAGTCGTTACGTGAAGCAGAATGCCAAACGCCGGTACTATTCCTCACGGCT
CGTGACACGGTGGATGATCGCGTTAAAGGCCTAGAATTAGGCGCAGATGACTATTTAGTTAAGCCCTTTGCCTTTGCCGA
ACTTCTAGCAAGGATAAGAACATTATTGCGCCGAGGCAGTCCCTCAACTTTTTCTGAGCTTCTTAAAGTAGCAGATCTGA
CTTTAGATTTACCTAAGCATCGCGTTACGCGGGCAGGTAAAAAAATAAATCTTAGCCACAAAGAGTTTTGTCTTTTAGAG
TTATTGGCACGTCGCCAAGGTGAGGTTCTACCACGCTCTTTGATTGCCTCTCAGGTATGGGACATGAATTTTGACTCTGA
CACCAACGTGATAGATGTGGCAATACGCCGCCTGCGAGCAAAAGTTGATGACGATTTTGAACCGAAACTTATCCATACGG
TTCGCGGTATGGGTTACAAACTTGACGTAGAGCCCGTTGATGAAGCCTTATAA

Protein sequence :
MRLLLVEDEVKTGDYLQKGLSEAGFQVNLVRNGLDGHHLAMTEAFDLIVLDVMLPDVDGWRILQSLREAECQTPVLFLTA
RDTVDDRVKGLELGADDYLVKPFAFAELLARIRTLLRRGSPSTFSELLKVADLTLDLPKHRVTRAGKKINLSHKEFCLLE
LLARRQGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKVDDDFEPKLIHTVRGMGYKLDVEPVDEAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-61 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-60 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Q7A_1812 YP_006296275.1 heavy metal response regulator BAC0083 Protein 4e-71 68
Q7A_1812 YP_006296275.1 heavy metal response regulator BAC0111 Protein 1e-74 68
Q7A_1812 YP_006296275.1 heavy metal response regulator BAC0638 Protein 1e-65 68
Q7A_1812 YP_006296275.1 heavy metal response regulator BAC0197 Protein 2e-69 64
Q7A_1812 YP_006296275.1 heavy metal response regulator BAC0308 Protein 6e-67 64
Q7A_1812 YP_006296275.1 heavy metal response regulator BAC0125 Protein 4e-65 63
Q7A_1812 YP_006296275.1 heavy metal response regulator BAC0347 Protein 6e-67 62
Q7A_1812 YP_006296275.1 heavy metal response regulator NC_007793.3914065.p0 Protein 1e-35 41
Q7A_1812 YP_006296275.1 heavy metal response regulator NC_007622.3794948.p0 Protein 1e-35 41
Q7A_1812 YP_006296275.1 heavy metal response regulator NC_002951.3238224.p0 Protein 1e-35 41
Q7A_1812 YP_006296275.1 heavy metal response regulator NC_002952.2859858.p0 Protein 1e-35 41
Q7A_1812 YP_006296275.1 heavy metal response regulator NC_013450.8614146.p0 Protein 1e-35 41
Q7A_1812 YP_006296275.1 heavy metal response regulator NC_010079.5776364.p0 Protein 1e-35 41
Q7A_1812 YP_006296275.1 heavy metal response regulator NC_003923.1003417.p0 Protein 1e-35 41
Q7A_1812 YP_006296275.1 heavy metal response regulator NC_002758.1121390.p0 Protein 1e-35 41
Q7A_1812 YP_006296275.1 heavy metal response regulator BAC0487 Protein 5e-30 41
Q7A_1812 YP_006296275.1 heavy metal response regulator AE000516.2.gene3505. Protein 1e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Q7A_1812 YP_006296275.1 heavy metal response regulator VFG0596 Protein 9e-62 58
Q7A_1812 YP_006296275.1 heavy metal response regulator VFG1390 Protein 5e-42 44
Q7A_1812 YP_006296275.1 heavy metal response regulator VFG1389 Protein 6e-37 43