Gene Information

Name : TY21A_09280 (TY21A_09280)
Accession : YP_007926142.1
Strain : Salmonella enterica Ty21a
Genome accession: NC_021176
Putative virulence/resistance : Virulence
Product : transcriptional regulatory protein YedW
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1886040 - 1886720 bp
Length : 681 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAGATTTTATTGATTGAAGATAACCAGAAAACCATTGAGTGGGTACGTCAGGGACTCACGGAGGCAGGCTATGTGGT
TGATTATGCCTGTGATGGACGAGACGGATTACACCTAGCCCTTCAGGAACATTATTCATTGATTATTCTTGATATTATGC
TGCCGGGGCTTGATGGATGGCAGGTTTTACGCGCGTTGCGCACTGCATATCAGCCCCCTGTTATTTGCCTGACGGCGCGC
GACTCGGTTGAGGATCGCGTCAAAGGTCTTGAGGCGGGCGCTAATGATTACCTTGTTAAGCCTTTTTCCTTCGCCGAACT
GCTGGCCCGGGTGAGAGCTCAACTCAGACAGCATGTCCCGGTCTTTACCCGACTGACGATCAATGGTCTGGACATGGATG
CCACAAAGCAATCGGTGTTACGAAATGGCAAACCGATTTCCCTGACCCGCAAAGAATTCCTGCTCCTCTGGTTACTGGCG
TCCCGGGCAGGGGAAATCGTGCCCCGAACCGCGATCGCCAGCGAAGTTTGGGGAATTAACTTTGATAGTGAAACCAACAC
CGTTGATGTCGCGATTCGTCGGCTGCGCGCCAAAGTAGACGATCCATTTGAAAAGAAGCTCATTATGACCGTCCAGGGGA
TGGGTTATCGATTACAGGCGGAAACGTCGCAGAATGGTTAA

Protein sequence :
MKILLIEDNQKTIEWVRQGLTEAGYVVDYACDGRDGLHLALQEHYSLIILDIMLPGLDGWQVLRALRTAYQPPVICLTAR
DSVEDRVKGLEAGANDYLVKPFSFAELLARVRAQLRQHVPVFTRLTINGLDMDATKQSVLRNGKPISLTRKEFLLLWLLA
SRAGEIVPRTAIASEVWGINFDSETNTVDVAIRRLRAKVDDPFEKKLIMTVQGMGYRLQAETSQNG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-101 98
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-100 97

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TY21A_09280 YP_007926142.1 transcriptional regulatory protein YedW BAC0083 Protein 5e-55 58
TY21A_09280 YP_007926142.1 transcriptional regulatory protein YedW BAC0197 Protein 2e-57 57
TY21A_09280 YP_007926142.1 transcriptional regulatory protein YedW BAC0125 Protein 5e-59 56
TY21A_09280 YP_007926142.1 transcriptional regulatory protein YedW BAC0638 Protein 1e-51 56
TY21A_09280 YP_007926142.1 transcriptional regulatory protein YedW BAC0308 Protein 6e-53 55
TY21A_09280 YP_007926142.1 transcriptional regulatory protein YedW BAC0111 Protein 6e-55 53
TY21A_09280 YP_007926142.1 transcriptional regulatory protein YedW BAC0347 Protein 3e-48 51
TY21A_09280 YP_007926142.1 transcriptional regulatory protein YedW NC_007793.3914065.p0 Protein 4e-37 44
TY21A_09280 YP_007926142.1 transcriptional regulatory protein YedW NC_007622.3794948.p0 Protein 4e-37 44
TY21A_09280 YP_007926142.1 transcriptional regulatory protein YedW NC_002951.3238224.p0 Protein 4e-37 44
TY21A_09280 YP_007926142.1 transcriptional regulatory protein YedW NC_002952.2859858.p0 Protein 4e-37 44
TY21A_09280 YP_007926142.1 transcriptional regulatory protein YedW NC_013450.8614146.p0 Protein 4e-37 44
TY21A_09280 YP_007926142.1 transcriptional regulatory protein YedW NC_010079.5776364.p0 Protein 4e-37 44
TY21A_09280 YP_007926142.1 transcriptional regulatory protein YedW NC_003923.1003417.p0 Protein 4e-37 44
TY21A_09280 YP_007926142.1 transcriptional regulatory protein YedW NC_002758.1121390.p0 Protein 4e-37 44
TY21A_09280 YP_007926142.1 transcriptional regulatory protein YedW AE015929.1.gene1106. Protein 4e-32 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TY21A_09280 YP_007926142.1 transcriptional regulatory protein YedW VFG0596 Protein 3e-101 98
TY21A_09280 YP_007926142.1 transcriptional regulatory protein YedW VFG0473 Protein 6e-30 42
TY21A_09280 YP_007926142.1 transcriptional regulatory protein YedW VFG1389 Protein 2e-30 42