Gene Information

Name : gcrR (SMU_1924)
Accession : NP_722229.1
Strain : Streptococcus mutans UA159
Genome accession: NC_004350
Putative virulence/resistance : Virulence
Product : response regulator GcrR for glucan-binding protein C
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1803462 - 1804154 bp
Length : 693 bp
Strand : -
Note : Best Blastp Hit: dbj|BAA85986.1| (AB024522) gcrR [Streptococcus mutans]

DNA sequence :
ATGGCTAAGGACATTTTAATTATTGAAGATGAAAAAAAACTTGCAAAGTTTGTTTCTTTAGAATTACAACATGAAGGATA
TGAGGTTGAAGTGACATATGATGGGCGTTCTGGCCTGGAAAGAGCACTTGAAAAAGATTTCGATCTCATCCTTCTTGATT
TAATGTTACCAGAGATGGACGGGTATGAAGTGATTCGTCGTTTACAATTGGAAAAGACAACTTATGTTATTATTATCACT
GCTCGTGACTCTATTATGGATATTGTGACTGGTCTTGATCGTGGAGCAGATGGTTATATCGTTAAACCATTTGCTATTGA
AGAATTACTAGCTCGTGTTCGTGCCATATTTCGTCGTCAAGATATTGAGAAAGCTAAGCATTCTTCTAAAAATGACACTA
CCTATCGTGATTTGAAATTAGATGTTCATAACCGAGCTGCCATTAGAAATGGTGAGACAATTCCTTTAACTAAACGTGAA
TTTGATTTATTAAATGCTCTTGTAGAAAATATCAATCAAGTCATGACTAGAGAAGAGCTTTTGGCCCGTGTTTGGAAGTA
TGATCAAGAAGCTGAAACTAATGTTGTCGATGTTTATATTCGCTATCTTCGTGGGAAGATTGATGTTCCCGGTAAAGAAA
GCTATATTCAGACTGTCCGCGGCATGGGGTATATCATTCGCGAAAATAATTAA

Protein sequence :
MAKDILIIEDEKKLAKFVSLELQHEGYEVEVTYDGRSGLERALEKDFDLILLDLMLPEMDGYEVIRRLQLEKTTYVIIIT
ARDSIMDIVTGLDRGADGYIVKPFAIEELLARVRAIFRRQDIEKAKHSSKNDTTYRDLKLDVHNRAAIRNGETIPLTKRE
FDLLNALVENINQVMTREELLARVWKYDQEAETNVVDVYIRYLRGKIDVPGKESYIQTVRGMGYIIRENN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-38 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-37 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
gcrR NP_722229.1 response regulator GcrR for glucan-binding protein C HE999704.1.gene1528. Protein 3e-57 61
gcrR NP_722229.1 response regulator GcrR for glucan-binding protein C NC_007793.3914065.p0 Protein 4e-51 52
gcrR NP_722229.1 response regulator GcrR for glucan-binding protein C NC_007622.3794948.p0 Protein 4e-51 52
gcrR NP_722229.1 response regulator GcrR for glucan-binding protein C NC_002951.3238224.p0 Protein 4e-51 52
gcrR NP_722229.1 response regulator GcrR for glucan-binding protein C NC_002952.2859858.p0 Protein 4e-51 52
gcrR NP_722229.1 response regulator GcrR for glucan-binding protein C NC_013450.8614146.p0 Protein 4e-51 52
gcrR NP_722229.1 response regulator GcrR for glucan-binding protein C NC_010079.5776364.p0 Protein 4e-51 52
gcrR NP_722229.1 response regulator GcrR for glucan-binding protein C NC_003923.1003417.p0 Protein 4e-51 52
gcrR NP_722229.1 response regulator GcrR for glucan-binding protein C NC_002758.1121390.p0 Protein 4e-51 52
gcrR NP_722229.1 response regulator GcrR for glucan-binding protein C AE015929.1.gene1106. Protein 6e-47 52
gcrR NP_722229.1 response regulator GcrR for glucan-binding protein C NC_012469.1.7685629. Protein 1e-36 42
gcrR NP_722229.1 response regulator GcrR for glucan-binding protein C BAC0197 Protein 4e-36 42
gcrR NP_722229.1 response regulator GcrR for glucan-binding protein C AE000516.2.gene3505. Protein 1e-32 42
gcrR NP_722229.1 response regulator GcrR for glucan-binding protein C BAC0125 Protein 4e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
gcrR NP_722229.1 response regulator GcrR for glucan-binding protein C VFG0596 Protein 1e-38 43
gcrR NP_722229.1 response regulator GcrR for glucan-binding protein C VFG1389 Protein 8e-37 43
gcrR NP_722229.1 response regulator GcrR for glucan-binding protein C VFG1390 Protein 6e-38 41