Gene Information

Name : yedV (ECB_01883)
Accession : YP_003045080.1
Strain : Escherichia coli REL606
Genome accession: NC_012967
Putative virulence/resistance : Virulence
Product : putative sensory kinase in two-component regulatory system with YedW
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0642
EC number : -
Position : 1974793 - 1976151 bp
Length : 1359 bp
Strand : -
Note : similar to b1968

DNA sequence :
ATGAAAAGATTATCTATAACCGTCCGTTTAACCTTGCTTTTTATATTGCTGCTGTCTGTTGCTGGCGCTGGAATTGTCTG
GACTCTCTATAATGGCCTGGCAAGTGAGTTGAAATGGCGCGATGATACAACACTCATTAACCGGACAGCACAGATCAAGC
AGTTGTTAATTGATGGGGTAAATCCAGATACGTTACCTGTATACTTTAACCGGATGATGGATGTTAGTCAGGATATCTTG
ATCATTCATGGTGATGGCATCAATAAAATTGTTAACCGGACAAATGTCAGTGATGACATGTTAAATAACATACCTGCTAG
TGAGACAATCAGCGCAGCTGGCATTTACAGAAGCATTATTAATGACACTGAGATTGATGCTTTACGAATTAATATTGATG
AAGTTTCGCCATCATTGACGGTTACTGTGGCTAAATTGGCTTCAGCCAGACATAACATGCTTGAACAGTATAAAATTAAT
AGCATTATAATTTGCATTGTCGCCATTGTACTTTGCTCAGTATTAAGTCCGCTGTTAATCAGAACGGGATTACGAGAGAT
CAAAAAGTTGAGTGGTGTAACGGAAGCGCTGAATTATAACGATAGCCGGGAGCCTGTTGAGGTTAGCGCATTACCGAGAG
AACTAAAACCTCTTGGGCAGGCGTTGAATAAAATGCATCAAGCCTTAGTCAAAGATTTTGAACGCCTAAGTCAATTTGCT
GACGATCTCGCTCATGAACTTAGAACGCCAATTAATGCATTACTGGGTCAGAATCAGGTTACGCTCAGTCAAACCAGAAG
TATCGCTGAATATCAAAAAACAATTGCCGGTAACATTGAAGAGCTGGAAAATATTTCGCGGTTAACAGAGAACATACTGT
TTCTTGCCAGGGCAGATAAAAACAATGTTTTGGTGAAACTGGACTCGCTTTCTCTCAATAAGGAAGTCGAAAATTTGTTG
GACTATCTTGAATATCTTTCAGACGAGAAAGAGATTTGCTTTAAGGTCGAGTGCAATCAGCAAATCTTTGCGGATAAAAT
TTTACTGCAACGAATGTTATCGAATCTTATTGTTAACGCCATTAGATATTCGCCAGAAAAATCGCGTATTCATATAACCA
GTTTTCTTGATACCAACAGCTATCTTAATATTGATATCGCCAGCCCTGGAACGAAAATTAATGAGCCTGAAAAACTCTTC
CGTAGATTTTGGCGGGGAGATAATTCGCGTCATTCCGTAGGTCAGGGACTTGGTCTTTCTTTAGTCAAAGCGATTGCCGA
ATTACATGGGGGAAGTGCTACGTATCACTATCTCAATAAGCATAATGTGTTCCGGATTACGTTGCCGCAAAGAAATTAA

Protein sequence :
MKRLSITVRLTLLFILLLSVAGAGIVWTLYNGLASELKWRDDTTLINRTAQIKQLLIDGVNPDTLPVYFNRMMDVSQDIL
IIHGDGINKIVNRTNVSDDMLNNIPASETISAAGIYRSIINDTEIDALRINIDEVSPSLTVTVAKLASARHNMLEQYKIN
SIIICIVAIVLCSVLSPLLIRTGLREIKKLSGVTEALNYNDSREPVEVSALPRELKPLGQALNKMHQALVKDFERLSQFA
DDLAHELRTPINALLGQNQVTLSQTRSIAEYQKTIAGNIEELENISRLTENILFLARADKNNVLVKLDSLSLNKEVENLL
DYLEYLSDEKEICFKVECNQQIFADKILLQRMLSNLIVNAIRYSPEKSRIHITSFLDTNSYLNIDIASPGTKINEPEKLF
RRFWRGDNSRHSVGQGLGLSLVKAIAELHGGSATYHYLNKHNVFRITLPQRN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copS AAC33720.1 histidine kinase Not tested SPI-5 Protein 3e-107 55
copS NP_460068.1 copper resistance protein Not tested SPI-5 Protein 7e-111 55

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedV YP_003045080.1 putative sensory kinase in two-component regulatory system with YedW VFG0595 Protein 3e-111 55