Gene Information

Name : STBHUCCB_19400 (STBHUCCB_19400)
Accession : YP_005217480.1
Strain : Salmonella enterica P-stx-12
Genome accession: NC_016832
Putative virulence/resistance : Virulence
Product : transcriptional regulatory protein yedW
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1882890 - 1883570 bp
Length : 681 bp
Strand : +
Note : similar to transcriptional regulatory protein YedW PRK11517; similar to Probable transcriptional regulatory protein yedW of Bacteria UniRef RepID=YEDW_ECOLI

DNA sequence :
ATGAAGATTTTATTGATTGAAGATAACCAGAAAACCATTGAGTGGGTACGTCAGGGACTCACGGAGGCAGGCTATGTGGT
TGATTATGCCTGTGATGGACGAGACGGATTACACCTAGCCCTTCAGGAACATTATTCATTGATTATTCTTGATATTATGC
TGCCGGGGCTTGATGGATGGCAGGTTTTACGCGCGTTGCGCACTGCATATCAGCCCCCTGTTATTTGCCTGACGGCGCGC
GACTCGGTTGAGGATCGCGTCAAAGGTCTTGAGGCGGGCGCTAATGATTACCTTGTTAAGCCTTTTTCCTTCGCCGAACT
GCTGGCCCGGGTGAGAGCTCAACTCAGACAGCATGTCCCGGTCTTTACCCGACTGACGATCAATGGTCTGGACATGGATG
CCACAAAGCAATCGGTGTTACGAAATGGCAAACCGATTTCCCTGACCCGCAAAGAATTCCTGCTCCTCTGGTTACTGGCG
TCCCGGGCAGGGGAAATCGTGCCCCGAACCGCGATCGCCAGCGAAGTTTGGGGAATTAACTTTGATAGTGAAACCAACAC
CGTTGATGTCGCGATTCGTCGGCTGCGCGCCAAAGTAGACGATCCATTTGAAAAGAAGCTCATTATGACCGTCCAGGGGA
TGGGTTATCGATTACAGGCGGAAACGTCGCAGAATGGTTAA

Protein sequence :
MKILLIEDNQKTIEWVRQGLTEAGYVVDYACDGRDGLHLALQEHYSLIILDIMLPGLDGWQVLRALRTAYQPPVICLTAR
DSVEDRVKGLEAGANDYLVKPFSFAELLARVRAQLRQHVPVFTRLTINGLDMDATKQSVLRNGKPISLTRKEFLLLWLLA
SRAGEIVPRTAIASEVWGINFDSETNTVDVAIRRLRAKVDDPFEKKLIMTVQGMGYRLQAETSQNG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-101 98
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-100 97

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STBHUCCB_19400 YP_005217480.1 transcriptional regulatory protein yedW BAC0083 Protein 5e-55 58
STBHUCCB_19400 YP_005217480.1 transcriptional regulatory protein yedW BAC0197 Protein 2e-57 57
STBHUCCB_19400 YP_005217480.1 transcriptional regulatory protein yedW BAC0125 Protein 5e-59 56
STBHUCCB_19400 YP_005217480.1 transcriptional regulatory protein yedW BAC0638 Protein 1e-51 56
STBHUCCB_19400 YP_005217480.1 transcriptional regulatory protein yedW BAC0308 Protein 6e-53 55
STBHUCCB_19400 YP_005217480.1 transcriptional regulatory protein yedW BAC0111 Protein 6e-55 53
STBHUCCB_19400 YP_005217480.1 transcriptional regulatory protein yedW BAC0347 Protein 3e-48 51
STBHUCCB_19400 YP_005217480.1 transcriptional regulatory protein yedW NC_007793.3914065.p0 Protein 4e-37 44
STBHUCCB_19400 YP_005217480.1 transcriptional regulatory protein yedW NC_007622.3794948.p0 Protein 4e-37 44
STBHUCCB_19400 YP_005217480.1 transcriptional regulatory protein yedW NC_002951.3238224.p0 Protein 4e-37 44
STBHUCCB_19400 YP_005217480.1 transcriptional regulatory protein yedW NC_002952.2859858.p0 Protein 4e-37 44
STBHUCCB_19400 YP_005217480.1 transcriptional regulatory protein yedW NC_013450.8614146.p0 Protein 4e-37 44
STBHUCCB_19400 YP_005217480.1 transcriptional regulatory protein yedW NC_010079.5776364.p0 Protein 4e-37 44
STBHUCCB_19400 YP_005217480.1 transcriptional regulatory protein yedW NC_003923.1003417.p0 Protein 4e-37 44
STBHUCCB_19400 YP_005217480.1 transcriptional regulatory protein yedW NC_002758.1121390.p0 Protein 4e-37 44
STBHUCCB_19400 YP_005217480.1 transcriptional regulatory protein yedW AE015929.1.gene1106. Protein 4e-32 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STBHUCCB_19400 YP_005217480.1 transcriptional regulatory protein yedW VFG0596 Protein 3e-101 98
STBHUCCB_19400 YP_005217480.1 transcriptional regulatory protein yedW VFG0473 Protein 6e-30 42
STBHUCCB_19400 YP_005217480.1 transcriptional regulatory protein yedW VFG1389 Protein 2e-30 42