Gene Information

Name : APA12_19640 (APA12_19640)
Accession : YP_005481700.1
Strain : Acetobacter pasteurianus IFO 3283
Genome accession: NC_017108
Putative virulence/resistance : Virulence
Product : two component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2141413 - 2142090 bp
Length : 678 bp
Strand : +
Note : -

DNA sequence :
ATGCGCGTTCTTCTTGTTGAAGACGATCAAACAGTTCGCAATTTTGTTGCCAAAGGCCTTGCAGAAGCTGGGCATTTGGT
TGAGCAGGCTGAAGACGGCAAAAATGGCCTCTCCCTTGCTACCAGCGAAAAGTTTGACGTCATCATTCTAGATCGCATGC
TGCCGGGCGGTGTAGAGGGCCTTCATATCCTACAAACATTGCGAAATCAAAACAATACAACCCCCGTGCTGCTGCTTTCC
GCCTTGGCCGATGTGGATGAAAAAGTGGCCGGACTGAAAGCAGGTGGGGATGATTACGTTACAAAGCCCTTCTCATTTTC
CGAACTTCAGGCACGTTTGGAAGCACTGGTCCGGCGCAACAGAAACGAAGCCCAGCCCCAGACGCGCCTTACAATTGGGG
ATCTGGAAATAGATCTGCTATCGCGCAATGTAAAACGCGCTGGCCAGAAGATTGAATTGCAACCGCGTGAATTCCGCCTG
TTGGAATTTTTGATGCGCCATGCCGGTCAGGTTGTTACCCGCACCATGCTGCTGGAAGGTGTATGGGATTATCATTTTGA
CCCCCAGACAAACGTCATTGACGTGCATATTTCCCGCCTGCGCCAGAAAATAGACAGACCTTTCCATCATCCACTGGTGC
ATACCATCCGTAATGCAGGATATATGCTGCAGGAATAG

Protein sequence :
MRVLLVEDDQTVRNFVAKGLAEAGHLVEQAEDGKNGLSLATSEKFDVIILDRMLPGGVEGLHILQTLRNQNNTTPVLLLS
ALADVDEKVAGLKAGGDDYVTKPFSFSELQARLEALVRRNRNEAQPQTRLTIGDLEIDLLSRNVKRAGQKIELQPREFRL
LEFLMRHAGQVVTRTMLLEGVWDYHFDPQTNVIDVHISRLRQKIDRPFHHPLVHTIRNAGYMLQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-44 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-43 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
APA12_19640 YP_005481700.1 two component response regulator BAC0125 Protein 2e-49 46
APA12_19640 YP_005481700.1 two component response regulator BAC0111 Protein 9e-53 46
APA12_19640 YP_005481700.1 two component response regulator BAC0197 Protein 5e-46 46
APA12_19640 YP_005481700.1 two component response regulator BAC0347 Protein 3e-49 45
APA12_19640 YP_005481700.1 two component response regulator BAC0083 Protein 1e-47 45
APA12_19640 YP_005481700.1 two component response regulator BAC0638 Protein 2e-42 45
APA12_19640 YP_005481700.1 two component response regulator BAC0308 Protein 1e-47 44
APA12_19640 YP_005481700.1 two component response regulator AE016830.1.gene1681. Protein 4e-40 41
APA12_19640 YP_005481700.1 two component response regulator CP001918.1.gene5135. Protein 2e-18 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
APA12_19640 YP_005481700.1 two component response regulator VFG0596 Protein 5e-45 45
APA12_19640 YP_005481700.1 two component response regulator VFG1389 Protein 4e-35 41