Gene Information

Name : yedV (ECS88_2020)
Accession : YP_002391735.1
Strain : Escherichia coli S88
Genome accession: NC_011742
Putative virulence/resistance : Virulence
Product : sensory kinase in two-component regulatory system with YedW
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0642
EC number : -
Position : 1991246 - 1992604 bp
Length : 1359 bp
Strand : -
Note : Evidence 1b : Function experimentally demonstrated in the studied species; PubMedId : 15522865; Product type rc : receptor

DNA sequence :
ATGAAAAGATTATCTATAACCGTCCGTTTAACCTTGCTTTTTATATTGCTGCTGTTTGTTGCTGGCGCTGGAATTGTCTG
GACTCTCTATAATGGCCTGGCAAGTGAGTTGAAATGGCGCGATGATACAACACTCATTAACCGGACAGCGCAGATCAAGC
AGTTGTTAATTGATGGGGTAAATCCAGATACGTTACCTGTGTACTTTAACCGGATGATGGATGTTAGTCAGGATATCTTG
ATCATTCATGGTGATGGCATCAATAAAATTGTTAACCGGACAAATGTCAGTAATGGCATGTTAAATAACATACCTGCTAG
TGAGACAATCAGCGCAGCTGGCATTTACAGAAGCATTATTAATGACACAGAGATAGATGCTTTACGAATTAATATTGATG
AAGTTTCGCCATCATTAACGGTTACTGTGGCTAAATTGGCTTCAGCCAGACATAACATGCTTGAACAGTATAAAATTAAT
AGCATTATAATTTGCATTGTCGCCATTATACTGTGCTCAGTATTAAGTCCGTTGTTAATCAGAACGGGGTTACGAGAGAT
CAAAAAGTTGAGTGGTGTAACGGAAGCGCTGAATTATAACGATAGCCGAGAGCCTGTTGAGGTTAGCGCATTACCGAGAG
AACTAAAACCTCTTGGGCAGGCGTTGAATAAAATGCACCAAGCTTTAGTCAAAGATTTTGAACGTCTAAGTCAGTTTGCT
GACGATCTCGCTCATGAACTTAGAACGCCAATTAATGCATTACTGGGTCAGAATCAGGTTACGCTCAGTCAAACCAGAAG
TATCGCTGAATATCAAAAAACAATTGCCGGAAACATTGAAGAGCTGGAAAATATTTCGCGATTAACAGAGAACATACTGT
TTCTTGCCAGGGCAGATAAAAATAATGTTTTGGTGAAACTGGACTCGCTTTCTCTCAATAATGAAGTCGAAAATTTGTTG
GACTATCTTGAATACCTTTCAGACGAGAAAGAGATTTGCTTTAAGGTCGAGTGCAATCAGCACATCTTTGCGGATAAAAT
TTTACTACAACGAATGTTATCGAATCTTATTGTTAACGCTATTCGATATTCGCCAGAAAAATCGCGTATTCAGATAACCA
GTTTTCTTGATACCAACGGTTCTCTTAATATTGATATCGCCAGTCCTGGAACGAAAATTCATGAGCCTGAAAAACTCTTC
CGTAGATTTTGGCGGGGAGATAATTCGCGTCATTCCGTAGGTCAGGGACTTGGTCTTTCTTTAGTCAAAGCGATTGCCGA
ATTACATGGGGGAAGTGCTACGTATCACTATCTCAGTAAGCATAATGTGTTCCGGATTACGTTACCGCAAAGAAATTAA

Protein sequence :
MKRLSITVRLTLLFILLLFVAGAGIVWTLYNGLASELKWRDDTTLINRTAQIKQLLIDGVNPDTLPVYFNRMMDVSQDIL
IIHGDGINKIVNRTNVSNGMLNNIPASETISAAGIYRSIINDTEIDALRINIDEVSPSLTVTVAKLASARHNMLEQYKIN
SIIICIVAIILCSVLSPLLIRTGLREIKKLSGVTEALNYNDSREPVEVSALPRELKPLGQALNKMHQALVKDFERLSQFA
DDLAHELRTPINALLGQNQVTLSQTRSIAEYQKTIAGNIEELENISRLTENILFLARADKNNVLVKLDSLSLNNEVENLL
DYLEYLSDEKEICFKVECNQHIFADKILLQRMLSNLIVNAIRYSPEKSRIQITSFLDTNGSLNIDIASPGTKIHEPEKLF
RRFWRGDNSRHSVGQGLGLSLVKAIAELHGGSATYHYLSKHNVFRITLPQRN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copS AAC33720.1 histidine kinase Not tested SPI-5 Protein 3e-100 55
copS NP_460068.1 copper resistance protein Not tested SPI-5 Protein 5e-104 55

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedV YP_002391735.1 sensory kinase in two-component regulatory system with YedW VFG0595 Protein 2e-104 55