Gene Information

Name : yedW (ECOPMV1_02057)
Accession : YP_008571897.1
Strain : Escherichia coli PMV-1
Genome accession: NC_022370
Putative virulence/resistance : Virulence
Product : putative transcriptional regulatory protein YedW
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2067090 - 2067872 bp
Length : 783 bp
Strand : -
Note : -

DNA sequence :
ATGAGTTTTGAGGATAGCGAAAAAACGTCCAGGGTAACCTTACAGCAGCATTACAATTTTGTAATGAACCAGGCTGTTTC
TATAACATATGATTTATGGCATATTATTTTCATGAAGATTCTACTTATTGAAGATAATCAAAGGACCCAGGAATGGGTAA
CGCAGGGGCTTTCCGAAGCGGGTTATGTCATTGATGCCGTTTCAGATGGCAGAGATGGGCTTTATCTTGCGCTGAAGGAT
GATTATGCATTGATCATTCTGGATATTATGCTTCCGGGTATGGATGGCTGGCAGATCTTACAAACGTTAAGAACAGCAAA
GCAAACCCCTGTTATTTGCCTTACTGCAAGGGATTCTGTCGATGACAGAGTCAGAGGGCTGGACAGTGGGGCAAATGATT
ATCTGGTAAAACCTTTTTCATTTTCTGAGTTGCTGGCAAGGGTTCGGGCACAATTAAGGCAACATCACGCTCTGAATTCA
TCATTAGAAATCAGCGGCTTAAGAATGGACTCTGTCAGTCAAAGTGTGAGCAGGGACAATATCAGTATTACACTGACGCG
CAAGGAGTTTCAGTTACTTTGGCTACTGGCCTCCAGAGCTGGCGAGATTATCCCCAGAACGGTTATTGCGAGTGAAATTT
GGGGAATCAACTTTGATAGTGATACCAATACGGTGGACGTCGCCATTCGCAGGCTCCGCGCAAAAGTTGATGATCCTTTT
CCTGAAAAGCTAATCTCCACAATCCGGGGGATGGGCTATTCATTCGTAGCGGTAAAAAAATAA

Protein sequence :
MSFEDSEKTSRVTLQQHYNFVMNQAVSITYDLWHIIFMKILLIEDNQRTQEWVTQGLSEAGYVIDAVSDGRDGLYLALKD
DYALIILDIMLPGMDGWQILQTLRTAKQTPVICLTARDSVDDRVRGLDSGANDYLVKPFSFSELLARVRAQLRQHHALNS
SLEISGLRMDSVSQSVSRDNISITLTRKEFQLLWLLASRAGEIIPRTVIASEIWGINFDSDTNTVDVAIRRLRAKVDDPF
PEKLISTIRGMGYSFVAVKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-80 77
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-82 74

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedW YP_008571897.1 putative transcriptional regulatory protein YedW BAC0125 Protein 1e-58 57
yedW YP_008571897.1 putative transcriptional regulatory protein YedW BAC0197 Protein 7e-56 55
yedW YP_008571897.1 putative transcriptional regulatory protein YedW BAC0083 Protein 3e-54 54
yedW YP_008571897.1 putative transcriptional regulatory protein YedW BAC0111 Protein 2e-55 52
yedW YP_008571897.1 putative transcriptional regulatory protein YedW BAC0308 Protein 7e-52 52
yedW YP_008571897.1 putative transcriptional regulatory protein YedW BAC0638 Protein 8e-49 52
yedW YP_008571897.1 putative transcriptional regulatory protein YedW BAC0347 Protein 8e-50 49
yedW YP_008571897.1 putative transcriptional regulatory protein YedW NC_007793.3914065.p0 Protein 6e-38 42
yedW YP_008571897.1 putative transcriptional regulatory protein YedW NC_007622.3794948.p0 Protein 6e-38 42
yedW YP_008571897.1 putative transcriptional regulatory protein YedW NC_002951.3238224.p0 Protein 6e-38 42
yedW YP_008571897.1 putative transcriptional regulatory protein YedW NC_002952.2859858.p0 Protein 6e-38 42
yedW YP_008571897.1 putative transcriptional regulatory protein YedW NC_013450.8614146.p0 Protein 6e-38 42
yedW YP_008571897.1 putative transcriptional regulatory protein YedW NC_010079.5776364.p0 Protein 6e-38 42
yedW YP_008571897.1 putative transcriptional regulatory protein YedW NC_003923.1003417.p0 Protein 6e-38 42
yedW YP_008571897.1 putative transcriptional regulatory protein YedW NC_002758.1121390.p0 Protein 6e-38 42
yedW YP_008571897.1 putative transcriptional regulatory protein YedW AE015929.1.gene1106. Protein 6e-33 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedW YP_008571897.1 putative transcriptional regulatory protein YedW VFG0596 Protein 6e-81 77