Gene Information

Name : NRG857_09830 (NRG857_09830)
Accession : YP_006120321.1
Strain : Escherichia coli NRG 857C
Genome accession: NC_017634
Putative virulence/resistance : Virulence
Product : transcriptional regulatory protein YedW
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2009112 - 2009894 bp
Length : 783 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAGTTTTGAGGATAGCGAAAAAACGTCCAGGGTAACCTTACAGCAGCATTACAATTTTGTAATGAACCAGGTTGTTTC
TATAACATATGATTTATGGCATATTATTTTCATGAAGATTCTACTTATTGAAGATAATCAAAGGACCCAGGAATGGGTAA
CGCAGGGGCTTTCCGAAGCGGGTTATGTCATTGATGCCGTTTCTGATGGCAGAGATGGGCTTTATCTTGCGCTGAAGGAT
GATTATGCATTGATCATTCTGGATATTATGCTTCCGGGTATGGATGGCTGGCAGATCTTACAAACGTTAAGAACGGCAAA
GCAAACCCCTGTTATTTGCCTTACTGCAAGGGATTCTGTCGATGACAGAGTCAGAGGGTTGGACAGTGGGGCAAATGATT
ATCTGGTAAAACCTTTTTCATTTTCTGAGTTGCTGGCAAGGGTTCGGGCACAATTAAGGCAACATCACGCTCTGAATTCA
ACATTAGAAATCAGTGGCTTAAAAATGGACTCTGTCAGTCAAAGTGTGAGCAGGGACAATATCAGTATTACACTGACGCG
CAAGGAGTTTCAGTTACTTTGGCTACTGGCCTCCAGAGCTGGCGAGATTATACCCAGAACGGTTATTGCGAGTGAAATTT
GGGGAATCAACTTTGATAGTGATACCAATACGGTGGATGTCGCCATTCGCAGGCTCCGCGCAAAAGTTGATGATCCTTTT
CCTGAAAAGCTAATCGCCACAATCCGGGGGATGGGCTATTCATTCGTAGCGGTAAAAAAATAA

Protein sequence :
MSFEDSEKTSRVTLQQHYNFVMNQVVSITYDLWHIIFMKILLIEDNQRTQEWVTQGLSEAGYVIDAVSDGRDGLYLALKD
DYALIILDIMLPGMDGWQILQTLRTAKQTPVICLTARDSVDDRVRGLDSGANDYLVKPFSFSELLARVRAQLRQHHALNS
TLEISGLKMDSVSQSVSRDNISITLTRKEFQLLWLLASRAGEIIPRTVIASEIWGINFDSDTNTVDVAIRRLRAKVDDPF
PEKLIATIRGMGYSFVAVKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-80 77
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-82 74

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NRG857_09830 YP_006120321.1 transcriptional regulatory protein YedW BAC0125 Protein 8e-59 57
NRG857_09830 YP_006120321.1 transcriptional regulatory protein YedW BAC0197 Protein 5e-56 56
NRG857_09830 YP_006120321.1 transcriptional regulatory protein YedW BAC0083 Protein 4e-54 54
NRG857_09830 YP_006120321.1 transcriptional regulatory protein YedW BAC0308 Protein 5e-52 53
NRG857_09830 YP_006120321.1 transcriptional regulatory protein YedW BAC0111 Protein 2e-55 52
NRG857_09830 YP_006120321.1 transcriptional regulatory protein YedW BAC0638 Protein 8e-49 52
NRG857_09830 YP_006120321.1 transcriptional regulatory protein YedW BAC0347 Protein 8e-50 49
NRG857_09830 YP_006120321.1 transcriptional regulatory protein YedW NC_007793.3914065.p0 Protein 3e-38 42
NRG857_09830 YP_006120321.1 transcriptional regulatory protein YedW NC_007622.3794948.p0 Protein 3e-38 42
NRG857_09830 YP_006120321.1 transcriptional regulatory protein YedW NC_002951.3238224.p0 Protein 3e-38 42
NRG857_09830 YP_006120321.1 transcriptional regulatory protein YedW NC_002952.2859858.p0 Protein 3e-38 42
NRG857_09830 YP_006120321.1 transcriptional regulatory protein YedW NC_013450.8614146.p0 Protein 3e-38 42
NRG857_09830 YP_006120321.1 transcriptional regulatory protein YedW NC_010079.5776364.p0 Protein 3e-38 42
NRG857_09830 YP_006120321.1 transcriptional regulatory protein YedW NC_003923.1003417.p0 Protein 3e-38 42
NRG857_09830 YP_006120321.1 transcriptional regulatory protein YedW NC_002758.1121390.p0 Protein 3e-38 42
NRG857_09830 YP_006120321.1 transcriptional regulatory protein YedW AE015929.1.gene1106. Protein 4e-33 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NRG857_09830 YP_006120321.1 transcriptional regulatory protein YedW VFG0596 Protein 4e-81 77