Gene Information

Name : pipB (SPUL_1968)
Accession : YP_005213126.1
Strain : Salmonella enterica RKS5078
Genome accession: NC_016831
Putative virulence/resistance : Virulence
Product : pathogenicity island protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1960613 - 1961488 bp
Length : 876 bp
Strand : +
Note : -

DNA sequence :
ATGCCAATAACTAACGCGTCCCCAGAAAATATATTAAGATATTTGCATGCGGCCGGTACCGGTACGAAAGAAGCAATGAA
AAGTGCAACTTCACCACGCGGTATACTGGAATGGTTTGTCAATTTTTTTACCTGTGGTGGAGTAAGAAGAAGCAATGAAA
GATGCTTTCAGGAGGTAATTGGAAAACTGACCACATCATTATTATATGTAAATAAAGATGCTTTCTTCGATGGTAATAAA
ATATTTCTGGAGGATGTCAACGGGTGTACTATATGTCTGTCATGTGGAGCAGCATCCGAAAATACGGCTCCCATGGTCAT
TATTGAAGTGAACAAAAATGGAAAAACTGTAACGGATAAAGTTGATAGTGAGAGATTTTGGAATGTATGCCGAATGTTAA
AGCTGATGAGTAAACATAATATACAACAGCCTGATTCACTTATAACCGAGGATGGTTTTCTGAACCTGCGCGGAGTAAAT
CTGGCTCATAAAGATTTCCAGGGGGAAGATTTGTCAGACATAGATGCTTCTGATGCAGATTTCCGTGAAACAACTCTATC
TAATGTAAATTTAGTCGGTGCAAATTTGTGTTGTGCAAATCTACACGCTGTAAATCTAATGGGTTCAAACATGACTAAAG
CAAACCTGACTCACGCAAACCTGACTTGCGCTAACATGTCCGGTGTAAACTTAACCGCTGCAATTCTATTCGGCTCAGAC
TTAACTGACACCAAACTAAATGGTGCGAAATTAGATAAGATAGCTCTAACTTTAGCGAAATCATTAACAGGAGCCGATCT
GACAGGTAGTCAACATACCCCTACTCCACTCCCGGATTACAATGATATAACTCTTTTCCCCCATCCGATATTTTAG

Protein sequence :
MPITNASPENILRYLHAAGTGTKEAMKSATSPRGILEWFVNFFTCGGVRRSNERCFQEVIGKLTTSLLYVNKDAFFDGNK
IFLEDVNGCTICLSCGAASENTAPMVIIEVNKNGKTVTDKVDSERFWNVCRMLKLMSKHNIQQPDSLITEDGFLNLRGVN
LAHKDFQGEDLSDIDASDADFRETTLSNVNLVGANLCCANLHAVNLMGSNMTKANLTHANLTCANMSGVNLTAAILFGSD
LTDTKLNGAKLDKIALTLAKSLTGADLTGSQHTPTPLPDYNDITLFPHPIF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
pipB AAC33725.1 PipB Virulence SPI-5 Protein 8e-130 98
pipB YP_216027.1 pathogenicity island encoded protein: SPI3 Virulence SPI-5 Protein 6e-129 98
pipB NP_455586.1 conserved hypothetical protein Virulence SPI-5 Protein 2e-129 98
pipB NP_460061.1 secreted effector protein Virulence SPI-5 Protein 2e-128 97

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pipB YP_005213126.1 pathogenicity island protein VFG0589 Protein 6e-129 97