Gene Information

Name : PFL_0200 (PFL_0200)
Accession : YP_257346.1
Strain : Pseudomonas protegens Pf-5
Genome accession: NC_004129
Putative virulence/resistance : Virulence
Product : DNA-binding heavy metal response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 235406 - 236086 bp
Length : 681 bp
Strand : +
Note : identified by match to protein family HMM PF00072; match to protein family HMM PF00486; match to protein family HMM TIGR01387

DNA sequence :
ATGCGTTTGCTGGTAGTTGAAGACGAAGCCAAGACCGCCCATTTCCTTGCCAAGGGCCTGGGAGAGTCCGGCTTTGCCGT
GGACGTGGCCCTGAACGGCCTGGACGGGCGCTATTTCATCGAGCAGCAGGAGTACGACCTGATCATCCTCGACGTCATGC
TCCCCGGCCTCAACGGCTGGCAGTTGCTGCAACTGGTGCGCCAGCGCGGTGCCACCCCGGTGCTGTTCCTCACTGCCCGC
GACGCTATCGAGGACCGGGTCCGCGGCCTGGAACTGGGCGCCGACGACTACCTGCTCAAGCCCTTCGCCTTTGCCGAGCT
ACTGGCCCGGGTGCGCACCCTGCTGCGCCGCGGACCGCTGCGCGAGGCCGAGTCCTTCAGCATCGCCGACCTGGAGATCG
ACGTGCTGCGCCGTCGCGTCAGCCGTGGCGGCCAGCGCATCGCCCTGACCAACAAGGAGTTCGCCCTGCTGCACCTGTTG
GCCAGCCGCCAGGGCGAAGTGCTGTCGCGGACCCTCATCGCCTCCCAGGTGTGGAACCTGAACTTCGACAGCGACACCAA
CATGGTGGAAGTAGCGGTACGAAGGTTGCGGGCCAAGGTCGACGACCCCTACATGCCCAAGCTGATCCACACCGTGCGTG
GCGTCGGCTACCAGCTGGAAGCCCCGGATGAAGCGCTCTAG

Protein sequence :
MRLLVVEDEAKTAHFLAKGLGESGFAVDVALNGLDGRYFIEQQEYDLIILDVMLPGLNGWQLLQLVRQRGATPVLFLTAR
DAIEDRVRGLELGADDYLLKPFAFAELLARVRTLLRRGPLREAESFSIADLEIDVLRRRVSRGGQRIALTNKEFALLHLL
ASRQGEVLSRTLIASQVWNLNFDSDTNMVEVAVRRLRAKVDDPYMPKLIHTVRGVGYQLEAPDEAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-57 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-56 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator BAC0125 Protein 3e-69 67
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator BAC0638 Protein 8e-60 64
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator BAC0083 Protein 3e-66 63
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator BAC0111 Protein 1e-65 62
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator BAC0197 Protein 3e-65 60
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator BAC0347 Protein 3e-59 59
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator BAC0308 Protein 2e-61 59
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator AE000516.2.gene3505. Protein 1e-31 45
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator NC_002952.2859905.p0 Protein 3e-34 43
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator NC_007622.3794472.p0 Protein 3e-34 43
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator NC_007793.3914279.p0 Protein 4e-34 43
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator NC_002951.3237708.p0 Protein 4e-34 43
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator NC_013450.8614421.p0 Protein 4e-34 43
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator NC_009782.5559369.p0 Protein 4e-34 43
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator NC_009641.5332272.p0 Protein 4e-34 43
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator NC_002745.1124361.p0 Protein 4e-34 43
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator NC_002758.1121668.p0 Protein 4e-34 43
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator NC_003923.1003749.p0 Protein 6e-34 43
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator NC_007793.3914065.p0 Protein 2e-37 42
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator NC_007622.3794948.p0 Protein 2e-37 42
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator NC_002951.3238224.p0 Protein 2e-37 42
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator NC_002952.2859858.p0 Protein 2e-37 42
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator NC_013450.8614146.p0 Protein 2e-37 42
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator NC_010079.5776364.p0 Protein 2e-37 42
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator NC_003923.1003417.p0 Protein 2e-37 42
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator NC_002758.1121390.p0 Protein 2e-37 42
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator HE999704.1.gene1528. Protein 1e-26 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator VFG0596 Protein 1e-57 57
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator VFG1390 Protein 2e-38 46
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator VFG1386 Protein 2e-33 42
PFL_0200 YP_257346.1 DNA-binding heavy metal response regulator VFG1389 Protein 2e-33 42