Gene Information

Name : LY180_10195 (LY180_10195)
Accession : YP_008565138.1
Strain : Escherichia coli LY180
Genome accession: NC_022364
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2127945 - 2128664 bp
Length : 720 bp
Strand : -
Note : induced by CusR in the presence of copper; YedW induces the expression of the upstream gene yedV (encoding a sensor kinase) as well as yedW; yedVW is one of four copper regulons found in E. coli; part of the copper homeostasis mechanism; confers resistanc

DNA sequence :
ATGAACCAGGCTGTTTCTATAACATATGATTTATGGCATATTATTTTCATGAAGATTTTACTTATTGAAGATAATCAAAG
GACCCAGGAGTGGGTAACGCAGGGGCTTTCCGAAGCGGGTTATGTCATTGATGCCGTTTCTGATGGCAGAGATGGGCTTT
ATCTTGCGCTGAAGGATGATTATGCATTGATCATTCTGGATATTATGCTTCCGGGTATGGATGGCTGGCAGATCTTACAA
ACGTTAAGAACAGCAAAGCAAACCCCTGTTATTTGCCTTACTGCAAGGGATTCTGTCGATGACAGAGTCAGAGGGCTGGA
CAGTGGAGCAAATGATTATCTGGTAAAACCTTTTTCATTTTCTGAGTTGCTGGCAAGGGTTCGGGCACAATTAAGGCAAC
ATCACGCTTTGAATTCAACATTAGAAATCAGTGGCTTAAGAATGGACTCTGTAAGTCAAAGTGTGAGCAGGGACAATATC
AGTATTACACTGACGCGCAAGGAGTTTCAGTTACTTTGGCTACTGGCCTCCAGAGCTGGCGAAATTATACCCAGAACGGT
TATTGCGAGTGAAATTTGGGGAATCAACTTTGATAGTGATACCAATACGGTGGATGTCGCCATTCGCAGGCTCCGCGCAA
AAGTTGATGATCCTTTTCCTGAAAAGCTAATCGCCACAATCCGGGGGATGGGCTATTCATTCGTAGCGGTAAAAAAATAA

Protein sequence :
MNQAVSITYDLWHIIFMKILLIEDNQRTQEWVTQGLSEAGYVIDAVSDGRDGLYLALKDDYALIILDIMLPGMDGWQILQ
TLRTAKQTPVICLTARDSVDDRVRGLDSGANDYLVKPFSFSELLARVRAQLRQHHALNSTLEISGLRMDSVSQSVSRDNI
SITLTRKEFQLLWLLASRAGEIIPRTVIASEIWGINFDSDTNTVDVAIRRLRAKVDDPFPEKLIATIRGMGYSFVAVKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-80 77
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-82 74

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LY180_10195 YP_008565138.1 transcriptional regulator BAC0125 Protein 1e-58 57
LY180_10195 YP_008565138.1 transcriptional regulator BAC0197 Protein 7e-56 56
LY180_10195 YP_008565138.1 transcriptional regulator BAC0083 Protein 3e-54 54
LY180_10195 YP_008565138.1 transcriptional regulator BAC0308 Protein 5e-52 53
LY180_10195 YP_008565138.1 transcriptional regulator BAC0111 Protein 1e-55 52
LY180_10195 YP_008565138.1 transcriptional regulator BAC0638 Protein 8e-49 52
LY180_10195 YP_008565138.1 transcriptional regulator BAC0347 Protein 6e-50 49
LY180_10195 YP_008565138.1 transcriptional regulator NC_007793.3914065.p0 Protein 2e-38 42
LY180_10195 YP_008565138.1 transcriptional regulator NC_007622.3794948.p0 Protein 2e-38 42
LY180_10195 YP_008565138.1 transcriptional regulator NC_002951.3238224.p0 Protein 2e-38 42
LY180_10195 YP_008565138.1 transcriptional regulator NC_002952.2859858.p0 Protein 2e-38 42
LY180_10195 YP_008565138.1 transcriptional regulator NC_013450.8614146.p0 Protein 2e-38 42
LY180_10195 YP_008565138.1 transcriptional regulator NC_010079.5776364.p0 Protein 2e-38 42
LY180_10195 YP_008565138.1 transcriptional regulator NC_003923.1003417.p0 Protein 2e-38 42
LY180_10195 YP_008565138.1 transcriptional regulator NC_002758.1121390.p0 Protein 2e-38 42
LY180_10195 YP_008565138.1 transcriptional regulator AE015929.1.gene1106. Protein 3e-33 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LY180_10195 YP_008565138.1 transcriptional regulator VFG0596 Protein 8e-81 77