Gene Information

Name : yedV (ECW_m2140)
Accession : YP_006124832.1
Strain : Escherichia coli W
Genome accession: NC_017635
Putative virulence/resistance : Virulence
Product : sensory kinase in two-component regulatory system with YedW
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2188205 - 2189563 bp
Length : 1359 bp
Strand : -
Note : -

DNA sequence :
ATGAAAAGATTATCTATAACCGTCCGTTTAACCTTGCTTTTTATATTGCTGCTGTCTGTTGCTGGCGCTGGAATTGTCTG
GACTCTCTATAATGGCCTGGCAAGTGAGTTGAAATGGCGCGATGATACAACACTCATTAACCGGACAGCACAGATCAAGC
AGTTGTTAATTGATGGGGTAAATCCAGATACGTTACCTGTATACTTTAACCGGATGATGGATGTTAGTCAGGATATCTTG
ATCATTCATGGTGATAGCATCAATAAAATTGTTAACCGGACAAATGTCAGTGATGACATGTTAAATAACATACCTGCTAG
TGAGACAATCAGCGCAGCTGGCATTTACAGAAGCATTATTAATGATACTGAGATTGATGCTTTACGAATTAATATTGATG
AAGTTTCGCCATCATTAACGGTTACTGTGGCTAAATTGGCTTCAGCCAGACATAACATGCTTGAACAGTATAAAATTAAT
AGCATTATAATTTGCATTGTCGCCATTGTACTTTGCTCAGTATTAAGTCCGCTGTTAATCAGAACGGGATTACGAGAGAT
CAAAAAGTTGAGTGGTGTAACGGAAGCGCTGAATTATAACGATAGCCGGGAGCCTGTTGAGGTTAGCGCATTACCGAGAG
AACTAAAACCTCTTGGGCAGGCGTTGAATAAAATGCATCAAGCCTTAGTCAAAGATTTTGAACGCCTAAGTCAATTTGCT
GACGATCTCGCTCATGAACTTAGAACGCCCATTAATGCATTACTGGGTCAGAATCAGGTTACGCTCAGTCAAACCAGAAG
TATCGCTGAATATCAAAAAACAATTGCCGGTAACATTGAAGAGCTGGAAAATATTTCGCGGTTAACAGAGAACATACTGT
TTCTTGCCCGGGCAGATAAAAACAATGTTTTGGTGAAACTGGACTCGCTTTCTCTCAATAAGGAAGTCGAAAATTTGTTG
GATTATCTTGAATACCTTTCAGACGAGAAAGAGATTTGCTTTAAGGTCGAGTGCAATCAGCAAATCTTTGCGGATAAAAT
TTTACTGCAACGAATGTTATCGAATCTTATTGTTAATGCCATTAGATATTCACCAGAAAAATCGCGTATTCATATAACCA
GTTTTCTTGATACCAACGGCTATCTTAATATTGATGTCGCCAGTCCTGGAACGAAAATTCATGAGCCTGAAAAACTCTTC
CGTAGATTTTGGCGGGGAGATAATTCGCGTCATTCCGTAGGTCAGGGACTTGGTCTTTCTTTAGTCAAAGCGATTGCCGA
ATTACATGGGGGAAGTGCTACGTATCACTATCTCAATAAGCATAATGTGTTCCGGATTACGTTACCGCAAAGAAATTAA

Protein sequence :
MKRLSITVRLTLLFILLLSVAGAGIVWTLYNGLASELKWRDDTTLINRTAQIKQLLIDGVNPDTLPVYFNRMMDVSQDIL
IIHGDSINKIVNRTNVSDDMLNNIPASETISAAGIYRSIINDTEIDALRINIDEVSPSLTVTVAKLASARHNMLEQYKIN
SIIICIVAIVLCSVLSPLLIRTGLREIKKLSGVTEALNYNDSREPVEVSALPRELKPLGQALNKMHQALVKDFERLSQFA
DDLAHELRTPINALLGQNQVTLSQTRSIAEYQKTIAGNIEELENISRLTENILFLARADKNNVLVKLDSLSLNKEVENLL
DYLEYLSDEKEICFKVECNQQIFADKILLQRMLSNLIVNAIRYSPEKSRIHITSFLDTNGYLNIDVASPGTKIHEPEKLF
RRFWRGDNSRHSVGQGLGLSLVKAIAELHGGSATYHYLNKHNVFRITLPQRN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copS AAC33720.1 histidine kinase Not tested SPI-5 Protein 4e-107 55
copS NP_460068.1 copper resistance protein Not tested SPI-5 Protein 8e-111 55

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedV YP_006124832.1 sensory kinase in two-component regulatory system with YedW VFG0595 Protein 3e-111 55