Gene Information

Name : Tmz1t_2101 (Tmz1t_2101)
Accession : YP_002355738.1
Strain : Thauera sp. MZ1T
Genome accession: NC_011662
Putative virulence/resistance : Virulence
Product : winged helix family two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2375460 - 2376146 bp
Length : 687 bp
Strand : +
Note : KEGG: bpt:Bpet4594 two-component response regulator; TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator; SMART: response regulator receiver

DNA sequence :
ATGAAGATCCTGGTCGTCGAAGACGAACTCAAACTCGCCGAATACCTGCGCAAGGCGCTGACCGAAAACAGCTACGTCGT
CGATGTCGCACACAGCGGCACCGAGGGTCGCTACCTCGCGATCGAAGGGCATTACGATCTCGTCCTGCTCGATGTCATGC
TGCCTGGCCTGGATGGTTTCGCCGTCCTGCGCGAATTGCGGCGCGACAAGCACGTACCGGTGCTGATGCTCACCGCGCGC
GACAAGGTGGAGGATCGCGTGAAGGGGCTGCAGGCGGGTGCGGACGACTATCTCGTGAAACCCTTCGCCCTGTCCGAACT
GCTCGCACGCGTCCAGGCGCTGTTACGGCGTGGCGCCCTCCCAACACCGGGTCAGGATTCCACCGTTCTCAAACTGGCCG
ACCTCGAACTCGATCTGGTCCGGCGCAAGGCGTCGCGCTCCGGACAGCGCCTCGATCTGACGGCCAAGGAGTTCACGCTG
CTGACCTTGCTGCTGCGCCGGCACGGGCAGGTCCTGTCGCGCACGGCACTGGCCGAGCAGGTGTGGGACATGAACTTCGA
GAGCAATACGAATGTCGTGGAGGTTGCGGTGCGCCGCTTGCGCAGCAAGCTCGATGACCCCTTCGCGAAGAAGCTGCTGC
ACACCGTGCGCGGCATGGGCTACGTGCTGGAAGACCGGGAACCCTGA

Protein sequence :
MKILVVEDELKLAEYLRKALTENSYVVDVAHSGTEGRYLAIEGHYDLVLLDVMLPGLDGFAVLRELRRDKHVPVLMLTAR
DKVEDRVKGLQAGADDYLVKPFALSELLARVQALLRRGALPTPGQDSTVLKLADLELDLVRRKASRSGQRLDLTAKEFTL
LTLLLRRHGQVLSRTALAEQVWDMNFESNTNVVEVAVRRLRSKLDDPFAKKLLHTVRGMGYVLEDREP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-58 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-57 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator BAC0197 Protein 3e-64 61
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator BAC0083 Protein 4e-63 60
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator BAC0638 Protein 3e-55 59
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator BAC0111 Protein 7e-61 56
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator BAC0125 Protein 7e-63 56
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator BAC0308 Protein 4e-57 55
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator BAC0347 Protein 3e-55 53
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator NC_002516.2.879194.p Protein 1e-33 45
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 1e-34 45
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 3e-32 44
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 1e-34 42
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator BAC0487 Protein 1e-30 41
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator CP000034.1.gene3834. Protein 2e-27 41
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator BAC0533 Protein 1e-27 41
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator NC_002695.1.915041.p Protein 2e-27 41
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator CP000647.1.gene4257. Protein 1e-27 41
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator U82965.2.orf14.gene. Protein 1e-27 41
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator CP001918.1.gene5135. Protein 5e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator VFG0596 Protein 2e-58 56
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator VFG1390 Protein 3e-44 47
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator VFG1389 Protein 7e-38 47
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator VFG1386 Protein 8e-38 43
Tmz1t_2101 YP_002355738.1 winged helix family two component heavy metal response transcriptional regulator VFG0473 Protein 7e-34 42