Gene Information

Name : MU9_2070 (MU9_2070)
Accession : YP_007505489.1
Strain : Morganella morganii KT
Genome accession: NC_020418
Putative virulence/resistance : Virulence
Product : Putative two-component system response regulator YedW
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2297145 - 2297813 bp
Length : 669 bp
Strand : +
Note : -

DNA sequence :
ATGAAAATATTACTGATTGAAGATCATGAAAAGACCGGCAGCTGGGTTAAAAAGGGATTAGAGGAAGCCGGATTTATTGT
TGATATCACGGCAGATGGCAGAGACGGGTTGTATCTTGCTCTGGAGAACAATTACCGGCTGGTTATTCTCGATATTATGT
TGCCCGGTATGGATGGCTGGGAAGTGCTGAGAATATTGAGAACCGCCAAAATGGTACCGGTTATTTGTCTGACAGCCAGG
GATGCAGTTGCTGACCGGGTAAAAGGACTGGAACTGGGCGCGAATGATTATCTGGTTAAACCGTTTTCATTTTCCGAATT
ACTGGCGAGAGTCCGGAATCAGCTGCGTACTTCTCAACCGGCTTCCAAAGTGATTGAGATCGCCGATCTCAGCATTGATC
TGACCCGTCATGATGTACAGCGGGGAGGCGTGAAAATATCGCTGACACGTCAGGAATATTCACTGTTGCTTTTTTTTGCG
CTGCATTCAGGGGAGATCCTGCCCAGAACACTGATTGCCTGTGAGGTATGGGGAATGGATTTTGAGAGTGATACCAATAT
TGTCGATGTGGCTGTCCGGCGGCTCAGAAAAAAAATAGATGACGATCATGATCGTAAATTAATTGAAACTGTCCGTGGTA
TGGGATACCGCCTGAACGGATCGGAATGA

Protein sequence :
MKILLIEDHEKTGSWVKKGLEEAGFIVDITADGRDGLYLALENNYRLVILDIMLPGMDGWEVLRILRTAKMVPVICLTAR
DAVADRVKGLELGANDYLVKPFSFSELLARVRNQLRTSQPASKVIEIADLSIDLTRHDVQRGGVKISLTRQEYSLLLFFA
LHSGEILPRTLIACEVWGMDFESDTNIVDVAVRRLRKKIDDDHDRKLIETVRGMGYRLNGSE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-69 66
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-68 64

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MU9_2070 YP_007505489.1 Putative two-component system response regulator YedW BAC0197 Protein 1e-55 59
MU9_2070 YP_007505489.1 Putative two-component system response regulator YedW BAC0125 Protein 2e-56 56
MU9_2070 YP_007505489.1 Putative two-component system response regulator YedW BAC0347 Protein 9e-55 55
MU9_2070 YP_007505489.1 Putative two-component system response regulator YedW BAC0083 Protein 3e-55 55
MU9_2070 YP_007505489.1 Putative two-component system response regulator YedW BAC0638 Protein 4e-53 55
MU9_2070 YP_007505489.1 Putative two-component system response regulator YedW BAC0111 Protein 4e-61 54
MU9_2070 YP_007505489.1 Putative two-component system response regulator YedW BAC0308 Protein 1e-53 54
MU9_2070 YP_007505489.1 Putative two-component system response regulator YedW NC_002952.2859858.p0 Protein 2e-37 42
MU9_2070 YP_007505489.1 Putative two-component system response regulator YedW NC_007622.3794948.p0 Protein 2e-37 42
MU9_2070 YP_007505489.1 Putative two-component system response regulator YedW AE015929.1.gene1106. Protein 2e-32 42
MU9_2070 YP_007505489.1 Putative two-component system response regulator YedW NC_003923.1003417.p0 Protein 2e-37 42
MU9_2070 YP_007505489.1 Putative two-component system response regulator YedW NC_013450.8614146.p0 Protein 2e-37 42
MU9_2070 YP_007505489.1 Putative two-component system response regulator YedW NC_002951.3238224.p0 Protein 2e-37 42
MU9_2070 YP_007505489.1 Putative two-component system response regulator YedW NC_007793.3914065.p0 Protein 2e-37 42
MU9_2070 YP_007505489.1 Putative two-component system response regulator YedW NC_002758.1121390.p0 Protein 2e-37 42
MU9_2070 YP_007505489.1 Putative two-component system response regulator YedW NC_010079.5776364.p0 Protein 2e-37 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MU9_2070 YP_007505489.1 Putative two-component system response regulator YedW VFG0596 Protein 3e-69 66
MU9_2070 YP_007505489.1 Putative two-component system response regulator YedW VFG1389 Protein 2e-32 41