Gene Information

Name : yedV (UTI89_C2167)
Accession : YP_541171.1
Strain : Escherichia coli UTI89
Genome accession: NC_007946
Putative virulence/resistance : Virulence
Product : 2-component sensor protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0642
EC number : -
Position : 2062818 - 2064176 bp
Length : 1359 bp
Strand : -
Note : -

DNA sequence :
ATGAAAAGATTATCTATAACCGTCCGTTTAACCTTGCTTTTTATATTGCTGCTGTTTGTTGCTGGCGCTGGAATTGTCTG
GACTCTCTATAATGGCCTGGCAAGTGAGTTGAAATGGCGCGATGATACAACACTCATTAACCGGACAGCGCAGATCAAGC
AGTTGTTAATTGATGGGGTAAATCCAGATACGTTACCTGTGTACTTTAACCGGATGATGGATGTTAGTCAGGATATCTTG
ATCATTCATGGTGATGGCATCAATAAAATTGTTAACCGGACAAATGTCAGTAATGGCATGTTAAATAACATACCTGCTAG
TGAGACAATCAGCGCAGCTGGCATTTACAGAAGCATTATTAATGACACAGAGATAGATGCTTTACGAATTAATATTGATG
AAGTTTCGCCATCATTAACGGTTACTGTGGCTAAATTGGCTTCAGCCAGACATAACATGCTTGAACAGTATAAAATTAAT
AGCATTATAATTTGCATTGTCGCCATTATACTGTGCTCAGTATTAAGTCCGTTGTTAATCAGAACGGGGTTACGAGAGAT
CAAAAAGTTGAGTGGTGTAACGGAAGCGCTGAATTATAACGATAGCCGAGAGCCTGTTGAGGTTAGCGCATTACCGAGAG
AACTAAAACCTCTTGGGCAGGCGTTGAATAAAATGCACCAAGCTTTAGTCAAAGATTTTGAACGTCTAAGTCAGTTTGCT
GACGATCTCGCTCATGAACTTAGAACGCCAATTAATGCATTACTGGGTCAGAATCAGGTTACGCTCAGTCAAACCAGAAG
TATCGCTGAATATCAAAAAACAATTGCCGGAAACATTGAAGAGCTGGAAAATATTTCGCGATTAACAGAGAACATACTGT
TTCTTGCCAGGGCAGATAAAAATAATGTTTTGGTGAAACTGGACTCGCTTTCTCTCAATAATGAAGTCGAAAATTTGTTG
GACTATCTTGAATACCTTTCAGACGAGAAAGAGATTTGCTTTAAGGTCGAGTGCAATCAGCACATCTTTGCGGATAAAAT
TTTACTACAACGAATGTTATCGAATCTTATTGTTAACGCTATTCGATATTCGCCAGAAAAATCGCGTATTCAGATAACCA
GTTTTCTTGATACCAACGGTTCTCTTAATATTGATATCGCCAGTCCTGGAACGAAAATTCATGAGCCTGAAAAACTCTTC
CGTAGATTTTGGCGGGGAGATAATTCGCGTCATTCCGTAGGTCAGGGACTTGGTCTTTCTTTAGTCAAAGCGATTGCCGA
ATTACATGGGGGAAGTGCTACGTATCACTATCTCAGTAAGCATAATGTGTTCCGGATTACGTTACCGCAAAGAAATTAA

Protein sequence :
MKRLSITVRLTLLFILLLFVAGAGIVWTLYNGLASELKWRDDTTLINRTAQIKQLLIDGVNPDTLPVYFNRMMDVSQDIL
IIHGDGINKIVNRTNVSNGMLNNIPASETISAAGIYRSIINDTEIDALRINIDEVSPSLTVTVAKLASARHNMLEQYKIN
SIIICIVAIILCSVLSPLLIRTGLREIKKLSGVTEALNYNDSREPVEVSALPRELKPLGQALNKMHQALVKDFERLSQFA
DDLAHELRTPINALLGQNQVTLSQTRSIAEYQKTIAGNIEELENISRLTENILFLARADKNNVLVKLDSLSLNNEVENLL
DYLEYLSDEKEICFKVECNQHIFADKILLQRMLSNLIVNAIRYSPEKSRIQITSFLDTNGSLNIDIASPGTKIHEPEKLF
RRFWRGDNSRHSVGQGLGLSLVKAIAELHGGSATYHYLSKHNVFRITLPQRN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copS AAC33720.1 histidine kinase Not tested SPI-5 Protein 3e-100 55
copS NP_460068.1 copper resistance protein Not tested SPI-5 Protein 5e-104 55

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedV YP_541171.1 2-component sensor protein VFG0595 Protein 2e-104 55