Gene Information

Name : EcE24377A_2199 (EcE24377A_2199)
Accession : YP_001463268.1
Strain : Escherichia coli E24377A
Genome accession: NC_009801
Putative virulence/resistance : Virulence
Product : heavy metal sensor histidine kinase
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0642
EC number : -
Position : 2166260 - 2167618 bp
Length : 1359 bp
Strand : -
Note : identified by match to protein family HMM PF00512; match to protein family HMM PF00672; match to protein family HMM PF02518; match to protein family HMM TIGR01386

DNA sequence :
ATGAAAAGATTATCTATAACCGTCCGTTTAACCTTGCTTTTTATATTGCTGCTGTCTGTTGCTGGCGCTGGAATTGTCTG
GACTCTCTATAATGGCCTGGCAAGTGAGTTGAAATGGCGCGATGATACAACACTCATTAACCGGACAGCACAGATCAAGC
AGTTGTTAATTGATGGGGTAAATCCAGATACGTTACCTGTATACTTTAACCGGATGATGGATGTTAGTCAGGATATCTTG
ATCATTCATGGTGATAGCATCAATAAAATTGTTAACCGGACAAATGTCAGTGATGACATGTTAAATAACATACCTGCTAG
TGAGACAATCAGCGCAGCTGGCATTTACAGAAGCATTATTAATGATACTGAGATTGATGCTTTACGAATTAATATTGATG
AAGTTTCGCCATCATTAACGGTTACTGTGGCTAAATTGGCTTCAGCCAGACATAACATGCTTGAACAGTATAAAATTAAT
AGCATTATAATTTGCATTGTCGCCATTGTACTTTGCTCAGTATTAAGTCCGCTGTTAATCAGAACGGGATTACGAGAGAT
CAAAAAGTTGAGTGGTGTAACGGAAGCGCTGAATTATAACGATAGCCGGGAGCCTGTTGAGGTTAGCGCATTACCGAGAG
AACTAAAACCTCTTGGGCAGGCGTTGAATAAAATGCATCAAGCCTTAGTCAAAGATTTTGAACGCCTAAGTCAATTTGCT
GACGATCTCGCTCATGAACTTAGAACGCCCATTAATGCATTACTGGGTCAGAATCAGGTTACGCTCAGTCAAACCAGAAG
TATCGCTGAATATCAAAAAACAATTGCCGGTAACATTGAAGAGCTGGAAAATATTTCGCGGTTAACAGAGAACATACTGT
TTCTTGCCCGGGCAGATAAAAACAATGTTTTGGTGAAACTGGACTCGCTTTCTCTCAATAAGGAAGTCGAAAATTTGTTG
GATTATCTTGAATACCTTTCAGACGAGAAAGAGATTTGCTTTAAGGTCGAGTGCAATCAGCAAATCTTTGCGGATAAAAT
TTTACTGCAACGAATGTTATCGAATCTTATTGTTAATGCCATTAGATATTCACCAGAAAAATCGCGTATTCATATAACCA
GTTTTCTTGATACCAACGGCTATCTTAATATTGATGTCGCCAGTCCTGGAACGAAAATTCATGAGCCTGAAAAACTCTTC
CGTAGATTTTGGCGGGGAGATAATTCGCGTCATTCCGTAGGTCAGGGACTTGGTCTTTCTTTAGTCAAAGCGATTGCCGA
ATTACATGGGGGAAGTGCTACGTATCACTATCTCAATAAGCATAATGTGTTCCGGATTATGTTACCGCAAAGAAATTAA

Protein sequence :
MKRLSITVRLTLLFILLLSVAGAGIVWTLYNGLASELKWRDDTTLINRTAQIKQLLIDGVNPDTLPVYFNRMMDVSQDIL
IIHGDSINKIVNRTNVSDDMLNNIPASETISAAGIYRSIINDTEIDALRINIDEVSPSLTVTVAKLASARHNMLEQYKIN
SIIICIVAIVLCSVLSPLLIRTGLREIKKLSGVTEALNYNDSREPVEVSALPRELKPLGQALNKMHQALVKDFERLSQFA
DDLAHELRTPINALLGQNQVTLSQTRSIAEYQKTIAGNIEELENISRLTENILFLARADKNNVLVKLDSLSLNKEVENLL
DYLEYLSDEKEICFKVECNQQIFADKILLQRMLSNLIVNAIRYSPEKSRIHITSFLDTNGYLNIDVASPGTKIHEPEKLF
RRFWRGDNSRHSVGQGLGLSLVKAIAELHGGSATYHYLNKHNVFRIMLPQRN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copS AAC33720.1 histidine kinase Not tested SPI-5 Protein 3e-107 55
copS NP_460068.1 copper resistance protein Not tested SPI-5 Protein 9e-111 55

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EcE24377A_2199 YP_001463268.1 heavy metal sensor histidine kinase VFG0595 Protein 4e-111 55