Gene Information

Name : cusR (MexAM1_META1p0223)
Accession : YP_002961462.1
Strain : Methylobacterium extorquens AM1
Genome accession: NC_012808
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system with CusS, regulation of copper resistance
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 241815 - 242513 bp
Length : 699 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 11283292, 11399769, 20461235; Product type r : regulator

DNA sequence :
ATGCGCCTGCTCATCATCGAGGACGACCGCGAGGCCGCCGCCTATCTGGTCAAAGCGTTCCGGGAAGCCGGGCACGCGGT
GGACCATGCGGGCGACGGCCTCGACGGCTATGCACTCGCCCGTGAGGGCGATTACGACGTGCTGATCGTCGATCGCATGT
TGCCGAAGCTCGACGGGCTCTCGCTCGTGCGCTCCCTGCGCGAGCAGGCGATCGCCACGCCGGTCCTCATCCTCTCGGCA
CTGGGCCAGGTGGACGACCGGGTGAAGGGTCTGCGGGCCGGGGGCGACGACTATCTCCCGAAGCCCTACGCCTTCTCCGA
GCTTCTCGCCCGCACCGAGGTGCTGGCCCGCCGCCGCACGGCCGCGACCGGCCAGAGCGAGGCCACCGCCTACCGGGTCG
GCGACCTCGAACTCGACCGGCTCTCGCACCGGGTGACGCGGGCGGGCCGCGAGATCGTGCTCCAACCCCGCGAGTTCCGG
CTGCTCGAATACCTCATGCGCCATGCCGGGCAGGTCGTGACCCGGACGATGCTGCTGGAGCATGTCTGGGACTACCATTT
CGATCCGCAGACCAACGTCATCGACGTCCACGTCTCGCGCCTGCGCGCGAAGATCGACCGCGGCTTCGAGCATCCGATGA
TCCATACGGTGCGCGGCGCGGGCTACGTCATCCGGGCGGACGAGCCGCAAGCCTCGTGA

Protein sequence :
MRLLIIEDDREAAAYLVKAFREAGHAVDHAGDGLDGYALAREGDYDVLIVDRMLPKLDGLSLVRSLREQAIATPVLILSA
LGQVDDRVKGLRAGGDDYLPKPYAFSELLARTEVLARRRTAATGQSEATAYRVGDLELDRLSHRVTRAGREIVLQPREFR
LLEYLMRHAGQVVTRTMLLEHVWDYHFDPQTNVIDVHVSRLRAKIDRGFEHPMIHTVRGAGYVIRADEPQAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-40 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-39 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_002961462.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0111 Protein 2e-57 50
cusR YP_002961462.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0083 Protein 9e-49 48
cusR YP_002961462.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0347 Protein 2e-50 47
cusR YP_002961462.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0125 Protein 1e-48 47
cusR YP_002961462.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0638 Protein 8e-41 47
cusR YP_002961462.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0197 Protein 1e-42 45
cusR YP_002961462.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0308 Protein 5e-44 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_002961462.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance VFG0596 Protein 1e-40 43
cusR YP_002961462.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance VFG1389 Protein 7e-35 43
cusR YP_002961462.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance VFG1390 Protein 7e-41 42