Gene Information

Name : SN31241_21560 (SN31241_21560)
Accession : YP_008360073.1
Strain : Salmonella enterica USMARC-S3124.1
Genome accession: NC_021902
Putative virulence/resistance : Virulence
Product : Secreted effector protein pipB
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2202552 - 2203427 bp
Length : 876 bp
Strand : -
Note : secreted effector protein PipB PRK15197; Secreted effector protein pipB of Salmonella enterica UniRef RepID=PIPB_SALTY

DNA sequence :
ATGCCAATAACTAACGCGTCCCCAGAAAATATATTAAGATATTTGCATGCGGCCGGTACCGGTACGAAAGAAGCAATGAA
AAGTGCAACTTCACCACGCGGTATACTGGAATGGTTTGTCAATTTTTTTACCTGTGGTGGAGTAAGAAGAAGCAATGAAA
GATGCTTTCGGGAGGTAATTGGAAAACTGACCACATCATTATTATATGTAAATAAAAATGCTTTCTTCGATGGTAATAAA
ATATTTCTGGAGGATGTCAACGGGTGTACTATATGTCTGTCATGTGGAGCAGCATCCGAAAATACGGATCCCATGGTCAT
TATTGAAGTGAACAAAAATGGAAAAACTGTAACGGATAAAGTTGATAGTGAGAGATTTTGGAATGTATGTCGAATGTTAA
AACTGATGAGTAAACATAATATACAACAGCCTGATTCACTTATAACCGAGGATGGTTTTCTGAACCTGCGCGGAGTAAAC
CTGGCTCATAAAGATTTCCAGGGGGAAGATTTGTCAAAAATAGATGCTTCTAATGCAGATTTCCGTGAAACAACTCTTTC
TAATGTAAATTTAGTCGGTGCAAATTTGTGTTGTGCAAATCTACACGCTGTAAATCTAATGGGTTCAAACATGACTAAAG
CAAACCTGACTCACGCAGACCTGACTTGCGCTAACATGTCCGGTGTAAACTTAACCGCTGCAATTCTATTCGGCTCAGAC
TTAACTGACACCAAACTAAATGGTGCGAAATTAGATAAGATAGCTCTAACTTTAGCGAAAGCATTAACAGGAGCCGATCT
GACAGGTAGTCAACATACCCCTACTCCACTCCCGGATTACAATGATAGAACTCTTTTCCCCCATCCGATATTTTAG

Protein sequence :
MPITNASPENILRYLHAAGTGTKEAMKSATSPRGILEWFVNFFTCGGVRRSNERCFREVIGKLTTSLLYVNKNAFFDGNK
IFLEDVNGCTICLSCGAASENTDPMVIIEVNKNGKTVTDKVDSERFWNVCRMLKLMSKHNIQQPDSLITEDGFLNLRGVN
LAHKDFQGEDLSKIDASNADFRETTLSNVNLVGANLCCANLHAVNLMGSNMTKANLTHADLTCANMSGVNLTAAILFGSD
LTDTKLNGAKLDKIALTLAKALTGADLTGSQHTPTPLPDYNDRTLFPHPIF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
pipB YP_216027.1 pathogenicity island encoded protein: SPI3 Virulence SPI-5 Protein 5e-130 99
pipB NP_460061.1 secreted effector protein Virulence SPI-5 Protein 5e-131 99
pipB AAC33725.1 PipB Virulence SPI-5 Protein 2e-130 98
pipB NP_455586.1 conserved hypothetical protein Virulence SPI-5 Protein 1e-130 98

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SN31241_21560 YP_008360073.1 Secreted effector protein pipB VFG0589 Protein 2e-131 99