Gene Information

Name : BurJV3_2171 (BurJV3_2171)
Accession : YP_004792720.1
Strain : Stenotrophomonas maltophilia JV3
Genome accession: NC_015947
Putative virulence/resistance : Virulence
Product : two component heavy metal response winged helix family transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2389792 - 2390481 bp
Length : 690 bp
Strand : -
Note : TIGRFAM: Signal transduction response regulator, heavy metal response; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; KEGG: hse:Hsero_2484 two component heavy metal response transcription

DNA sequence :
ATGAAACTGCTGATCGTCGAGGATGAGAGCAAGACCGCCCACTACCTGCGCACCGGCCTGGGTGAGCAGGGCTGGGCGGT
GGACCTCGCGGCCGACGGCGTGACCGGCCTGCACCTGGCGCGCGAATTCGACTACGACGTGATCGTGCTGGACGTGATGC
TGCCCGGCATGGATGGCTTCAATGTGCTGCGCGAACTGCGTCGCAGCAAGCAGACCCCGGTGATCATGCTGACCGCCCGC
GACCGCGTGGACGACCGCGTGCACGGGCTGGGGCAGGGGGCCGATGACTACCTGGTCAAGCCGTTCTCGTTCATCGAACT
GCTGGCACGCCTGCAGGCGCTGGTCCGGCGCGGCCGCCAGCAGGAACCCACCGAACTGCAGGTGGGCGATCTGCAGGTCA
ACCTGCTGGCGCGGCGCGCCTATCGTGACGGCGCGCGACTGGACCTGACCGGCAAGGAATTCGCGCTGCTGGCCCTGCTG
GCACAGCGCCGCGGGCAGATCCTGTCCAAGACGGTGATTGCCGCCCAGGTCTGGGACATCAATTTCGACAGCAACACCAA
CGTGGTGGAAGTGGCGATCAAGCGCCTGCGCAGCAAGCTCGATGGCCCGTACCCGAGCAAGCTGCTGCATACCGTGCGCG
GCATGGGCTACGTGCTGGAAGTGCGAGACGACGAGGACGATGGCCGATGA

Protein sequence :
MKLLIVEDESKTAHYLRTGLGEQGWAVDLAADGVTGLHLAREFDYDVIVLDVMLPGMDGFNVLRELRRSKQTPVIMLTAR
DRVDDRVHGLGQGADDYLVKPFSFIELLARLQALVRRGRQQEPTELQVGDLQVNLLARRAYRDGARLDLTGKEFALLALL
AQRRGQILSKTVIAAQVWDINFDSNTNVVEVAIKRLRSKLDGPYPSKLLHTVRGMGYVLEVRDDEDDGR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-50 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-49 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator BAC0083 Protein 6e-57 60
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator BAC0197 Protein 6e-60 59
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator BAC0125 Protein 2e-61 58
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator BAC0638 Protein 5e-52 54
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator BAC0111 Protein 2e-56 53
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator BAC0308 Protein 2e-52 51
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator BAC0347 Protein 5e-50 49
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator CP001918.1.gene5135. Protein 3e-20 42
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator NC_002951.3238224.p0 Protein 1e-32 41
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator NC_007793.3914065.p0 Protein 1e-32 41
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator NC_002758.1121390.p0 Protein 1e-32 41
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator NC_010079.5776364.p0 Protein 1e-32 41
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator NC_002952.2859858.p0 Protein 1e-32 41
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator NC_007622.3794948.p0 Protein 1e-32 41
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator NC_003923.1003417.p0 Protein 1e-32 41
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator NC_013450.8614146.p0 Protein 1e-32 41
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator NC_002516.2.879194.p Protein 3e-31 41
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator HE999704.1.gene1528. Protein 3e-29 41
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator BAC0533 Protein 4e-21 41
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator CP000647.1.gene4257. Protein 4e-21 41
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator CP004022.1.gene3215. Protein 2e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator VFG0596 Protein 2e-50 54
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator VFG1389 Protein 3e-33 46
BurJV3_2171 YP_004792720.1 two component heavy metal response winged helix family transcriptional regulator VFG1390 Protein 5e-36 42