Gene Information

Name : yedW (CE10_2247)
Accession : YP_006144313.1
Strain : Escherichia coli CE10
Genome accession: NC_017646
Putative virulence/resistance : Virulence
Product : putative DNA-binding response regulator in two-component system with YedV
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2253956 - 2254738 bp
Length : 783 bp
Strand : -
Note : -

DNA sequence :
ATGAGTTTTGAGGATAGCGAAAAAACGTCCAGGGTAACCTTACAGCAGCATTACAATTTTGTAATGAACCAGGTTGTTTC
TATAACATATGATTTATGGCATATTATTTTCATGAAGATTCTACTTATTGAAGATAATCAAAGGACCCAGGAATGGGTAA
CGCAGGGGCTTTCCGAAGCGGGTTATGTCATTGATGCCGTTTCTGATGGCAGAGATGGGCTTTATCTTGCGCTGAAGGAT
GATTATGCATTGATCATTCTGGATATTATGCTTCCGGGTATGGATGGCTGGCAGATCTTACAAACGTTGAGAACGGCAAA
GCAAACCCCTGTTATTTGCCTTACTGCAAGGGATTCTGTCGATGACAGAGTCAGAGGGCTGGACAGTGGGGCAAATGATT
ATCTGGTAAAACCTTTTTCATTTTCTGAGTTGCTGGCAAGGGTTCGGGCACAATTAAGGCAACATTACACTCTGAATTCA
ACATTAGAAATCAGTGGCTTAAAAATGGACTCTGTCAGTCAAAGTGTGAGCAGGGACAATATCAGTATTACACTGACGCG
CAAGGAGTTTCAGTTACTTTGGCTACTGGCCTCCAGAGCTGGCGAGATTATACCCAGAACGGTTATTGCGAGTGAAATTT
GGGGAATCAACTTTGATAGTGATACCAATACGGTGGATGTCGCCATTCGCAGGCTCCGCGCAAAAGTTGATGATCCTTTT
CCTGAAAAGCTAATCGCCACAATCCGGGGGATGGGCTATTCATTCGTAGCGGTAAAAAAATAA

Protein sequence :
MSFEDSEKTSRVTLQQHYNFVMNQVVSITYDLWHIIFMKILLIEDNQRTQEWVTQGLSEAGYVIDAVSDGRDGLYLALKD
DYALIILDIMLPGMDGWQILQTLRTAKQTPVICLTARDSVDDRVRGLDSGANDYLVKPFSFSELLARVRAQLRQHYTLNS
TLEISGLKMDSVSQSVSRDNISITLTRKEFQLLWLLASRAGEIIPRTVIASEIWGINFDSDTNTVDVAIRRLRAKVDDPF
PEKLIATIRGMGYSFVAVKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-80 77
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-82 74

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedW YP_006144313.1 putative DNA-binding response regulator in two-component system with YedV BAC0125 Protein 1e-58 57
yedW YP_006144313.1 putative DNA-binding response regulator in two-component system with YedV BAC0197 Protein 4e-55 55
yedW YP_006144313.1 putative DNA-binding response regulator in two-component system with YedV BAC0083 Protein 8e-54 54
yedW YP_006144313.1 putative DNA-binding response regulator in two-component system with YedV BAC0308 Protein 3e-51 53
yedW YP_006144313.1 putative DNA-binding response regulator in two-component system with YedV BAC0111 Protein 6e-55 52
yedW YP_006144313.1 putative DNA-binding response regulator in two-component system with YedV BAC0638 Protein 1e-48 52
yedW YP_006144313.1 putative DNA-binding response regulator in two-component system with YedV BAC0347 Protein 3e-49 49
yedW YP_006144313.1 putative DNA-binding response regulator in two-component system with YedV NC_010079.5776364.p0 Protein 7e-38 42
yedW YP_006144313.1 putative DNA-binding response regulator in two-component system with YedV NC_002952.2859858.p0 Protein 7e-38 42
yedW YP_006144313.1 putative DNA-binding response regulator in two-component system with YedV NC_007622.3794948.p0 Protein 7e-38 42
yedW YP_006144313.1 putative DNA-binding response regulator in two-component system with YedV AE015929.1.gene1106. Protein 2e-32 42
yedW YP_006144313.1 putative DNA-binding response regulator in two-component system with YedV NC_003923.1003417.p0 Protein 7e-38 42
yedW YP_006144313.1 putative DNA-binding response regulator in two-component system with YedV NC_013450.8614146.p0 Protein 7e-38 42
yedW YP_006144313.1 putative DNA-binding response regulator in two-component system with YedV NC_002951.3238224.p0 Protein 7e-38 42
yedW YP_006144313.1 putative DNA-binding response regulator in two-component system with YedV NC_007793.3914065.p0 Protein 7e-38 42
yedW YP_006144313.1 putative DNA-binding response regulator in two-component system with YedV NC_002758.1121390.p0 Protein 7e-38 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedW YP_006144313.1 putative DNA-binding response regulator in two-component system with YedV VFG0596 Protein 7e-81 77