Gene Information

Name : copR1 (Rmet_6111)
Accession : YP_581920.1
Strain :
Genome accession: NC_007971
Putative virulence/resistance : Virulence
Product : regulator protein CopR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 191403 - 192089 bp
Length : 687 bp
Strand : +
Note : from the two components sensor/regulator family involved in Cu(II)/Cu(I) resistance

DNA sequence :
ATGAAACTGCTGGTAGTGGAAGATGAAGTCAAGACGGGGGAGTATCTCCGGCAGGGCCTGACCGAGGCGGGGTTCGTGGT
CGACCTGGTCGCCAATGGACTCGATGGTCAACACTTTGCGGTCAATGAAACCTACGATCTCATCATCCTCGATGTCATGC
TGCCCGACGTCGACGGATGGCATATTCTGCATGCCATCCGCGCGTCAGGGAACGCGGTCCCGGTCTTGTTTCTGACGGCG
CGAGACAGTGTTGCCGATCGCGTGCGAGGCCTCGAGCTCGGCGCGGATGACTATCTGGTCAAGCCATTTGCCTTTTCGGA
GCTGCTTGCCAGGGTCAGGACGCTGCTGCGTCGAGGCGCGGTGCAACTAGCGATGGACCGGATTCAAGTGGCCGATCTGA
TTCTGGATCTGAGCCGGCGGCGAGCGTCTCGCGGTGGGCGACGCATCACGCTGACCAGTAAGGAATTCGCCTTGCTCGAG
TTGTTTGCGCGTCGAAGGGGGGAGGTGCTTCCCCGATCCCTCATTGCCTCCCAGGTGTGGGACATGAACTTCGATAGCGA
TAGTAACGTGATCGACGTGGCGATCCGGCGCCTGCGGGCAAAAATCGATGACGGCTTTGAAGTAAAGCTGATCCAGACTG
TGCGCGGCATGGGATACGTCCTCGAGGCACCTGAGGATCCTCTATGA

Protein sequence :
MKLLVVEDEVKTGEYLRQGLTEAGFVVDLVANGLDGQHFAVNETYDLIILDVMLPDVDGWHILHAIRASGNAVPVLFLTA
RDSVADRVRGLELGADDYLVKPFAFSELLARVRTLLRRGAVQLAMDRIQVADLILDLSRRRASRGGRRITLTSKEFALLE
LFARRRGEVLPRSLIASQVWDMNFDSDSNVIDVAIRRLRAKIDDGFEVKLIQTVRGMGYVLEAPEDPL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-57 59
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-56 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR1 YP_581920.1 regulator protein CopR BAC0083 Protein 3e-69 70
copR1 YP_581920.1 regulator protein CopR BAC0638 Protein 7e-64 70
copR1 YP_581920.1 regulator protein CopR BAC0111 Protein 4e-72 69
copR1 YP_581920.1 regulator protein CopR BAC0308 Protein 7e-62 64
copR1 YP_581920.1 regulator protein CopR BAC0197 Protein 1e-63 64
copR1 YP_581920.1 regulator protein CopR BAC0347 Protein 3e-64 63
copR1 YP_581920.1 regulator protein CopR BAC0125 Protein 2e-62 63
copR1 YP_581920.1 regulator protein CopR NC_007793.3914065.p0 Protein 1e-33 42
copR1 YP_581920.1 regulator protein CopR NC_007622.3794948.p0 Protein 1e-33 42
copR1 YP_581920.1 regulator protein CopR NC_002951.3238224.p0 Protein 1e-33 42
copR1 YP_581920.1 regulator protein CopR NC_002952.2859858.p0 Protein 1e-33 42
copR1 YP_581920.1 regulator protein CopR NC_013450.8614146.p0 Protein 1e-33 42
copR1 YP_581920.1 regulator protein CopR NC_010079.5776364.p0 Protein 1e-33 42
copR1 YP_581920.1 regulator protein CopR NC_003923.1003417.p0 Protein 1e-33 42
copR1 YP_581920.1 regulator protein CopR NC_002758.1121390.p0 Protein 1e-33 42
copR1 YP_581920.1 regulator protein CopR BAC0487 Protein 3e-30 41
copR1 YP_581920.1 regulator protein CopR NC_007622.3794472.p0 Protein 7e-31 41
copR1 YP_581920.1 regulator protein CopR NC_002952.2859905.p0 Protein 8e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR1 YP_581920.1 regulator protein CopR VFG0596 Protein 2e-57 59
copR1 YP_581920.1 regulator protein CopR VFG1390 Protein 8e-39 45
copR1 YP_581920.1 regulator protein CopR VFG1389 Protein 9e-33 44
copR1 YP_581920.1 regulator protein CopR VFG1386 Protein 8e-33 42