Gene Information

Name : Dd586_0224 (Dd586_0224)
Accession : YP_003331826.1
Strain : Dickeya dadantii Ech586
Genome accession: NC_013592
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 260346 - 261017 bp
Length : 672 bp
Strand : +
Note : KEGG: dda:Dd703_3722 two component heavy metal response transcriptional regulator, winged helix family; TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receive

DNA sequence :
ATGCGTATTCTGGTGGTTGAAGACGATGGCAGTACCGGCGATTACCTGAAAAAAGGACTCACCGAAGCCGGTTATGCCGT
TGATCTGGCACGTAACGGTACCGACGGGTTATTTAATGCGCTTGAGCACAGTTACGACGCCATCATTCTGGATGTGATGT
TGCCGGGGCTTAACGGTTGGCAAATTATTGAGATGCTGCGTAAAAAAAGCGATGTACCGGTGCTGTTTCTGACGGCGCGC
GACCAGTTACACGACCGTATTCACGGGTTGGAATTGGGGGCCGACGACTACCTGATTAAACCGTTTTCGTTTACCGAGCT
GGTGTTGCGTATTCGCACGTTGCTGCGCCGGGGTGTGGTCCGTGAAGCCGATCACTACGCCGTGGCGGACTTACGCCTCG
ACGTATTGCGGCGTAAGGCTACCCGGCAAGAGGTGGTGATCCCGCTCACCAATAAAGAGTTTATGTTGCTGCATCTGCTG
GTGCGGCGCGAAGGTGAGGTGCTCTCGCGCACGTTGATTGCTTCGCAGGTATGGGACATGAATTTTGATAGTGATACCAA
CGTGGTGGATGTGGCAGTGAAACGCTTACGCGCCAAGATAGACAAACCATTCGATATCAAGCTCATCCACACGGTGCGCG
GTATTGGCTATGTGTGCGAGCCGCGTTCATGA

Protein sequence :
MRILVVEDDGSTGDYLKKGLTEAGYAVDLARNGTDGLFNALEHSYDAIILDVMLPGLNGWQIIEMLRKKSDVPVLFLTAR
DQLHDRIHGLELGADDYLIKPFSFTELVLRIRTLLRRGVVREADHYAVADLRLDVLRRKATRQEVVIPLTNKEFMLLHLL
VRREGEVLSRTLIASQVWDMNFDSDTNVVDVAVKRLRAKIDKPFDIKLIHTVRGIGYVCEPRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-54 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-53 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator BAC0197 Protein 8e-67 64
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator BAC0125 Protein 6e-66 63
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-61 61
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator BAC0111 Protein 3e-62 60
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-56 60
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-62 59
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-53 56
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-36 43
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-36 43
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-36 43
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-36 43
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-36 43
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-36 43
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-36 43
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-36 43
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-29 43
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 1e-23 41
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator U82965.2.orf14.gene. Protein 2e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator VFG0596 Protein 4e-55 54
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-38 43
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator VFG1386 Protein 4e-34 43
Dd586_0224 YP_003331826.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-34 43