Gene Information

Name : CLD_2250 (CLD_2250)
Accession : YP_001781933.1
Strain : Clostridium botulinum Okra
Genome accession: NC_010516
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2507533 - 2508213 bp
Length : 681 bp
Strand : -
Note : identified by match to protein family HMM PF00072; match to protein family HMM PF00486

DNA sequence :
ATGGTTAAGATTTTAATAGTTGAAGATGAAGAGAAATTATCAAGATTTATTGAGCTTGAGTTAAAACACGAAGGATATGA
AATAGTAAAAGCAAATAATGGTAGAACGGGTCTTGAAATTGCAGAAAAAGGTGAGGCTGATTTAGTTCTTCTTGATATAA
TGCTTCCAGAAATAAACGGTCTTGAAGTATTAAGAAGGCTTAGAAGAACTTCTGATATTCCAATTATAATGCTTACTGCA
AGGGATGCAGTTATGGATAAAGTATCAGGTCTTGATGCAGGAGCAGATGATTATATAACTAAGCCATTTGCAATAGAAGA
GTTACTTGCAAGAATAAGAACAGCCCTTAAAAAGAGAATAGTTACAGTGAAGAAAGATGAAGATATAATAAGATGTGGCT
TATTGTCATTAGATAAAATGAGACATAAAGTAATGTATGATAGCACAGAGATAGAACTAACCAATAGAGAGTTTAATTTG
TTACAAATATTAATGGAAAACAAGAATATAGTGTTAACCAGAAGTATACTTATGGAAAAGGTATGTGGTTATGATTATCT
TGGAGAAACCAATGTTATAGATGTTTATATAAGGTTTTTGAGAACAAAAATAGATGATGCTTTTAAGGTTAAAATAATAA
CTACAGTTCGTGGTGTAGGATACGTAATTAAAGATGAGTAG

Protein sequence :
MVKILIVEDEEKLSRFIELELKHEGYEIVKANNGRTGLEIAEKGEADLVLLDIMLPEINGLEVLRRLRRTSDIPIIMLTA
RDAVMDKVSGLDAGADDYITKPFAIEELLARIRTALKKRIVTVKKDEDIIRCGLLSLDKMRHKVMYDSTEIELTNREFNL
LQILMENKNIVLTRSILMEKVCGYDYLGETNVIDVYIRFLRTKIDDAFKVKIITTVRGVGYVIKDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLD_2250 YP_001781933.1 DNA-binding response regulator HE999704.1.gene1528. Protein 2e-47 56
CLD_2250 YP_001781933.1 DNA-binding response regulator NC_007793.3914065.p0 Protein 8e-47 51
CLD_2250 YP_001781933.1 DNA-binding response regulator NC_007622.3794948.p0 Protein 8e-47 51
CLD_2250 YP_001781933.1 DNA-binding response regulator NC_002951.3238224.p0 Protein 8e-47 51
CLD_2250 YP_001781933.1 DNA-binding response regulator NC_002952.2859858.p0 Protein 8e-47 51
CLD_2250 YP_001781933.1 DNA-binding response regulator NC_013450.8614146.p0 Protein 8e-47 51
CLD_2250 YP_001781933.1 DNA-binding response regulator NC_010079.5776364.p0 Protein 8e-47 51
CLD_2250 YP_001781933.1 DNA-binding response regulator NC_003923.1003417.p0 Protein 8e-47 51
CLD_2250 YP_001781933.1 DNA-binding response regulator NC_002758.1121390.p0 Protein 8e-47 51
CLD_2250 YP_001781933.1 DNA-binding response regulator AE015929.1.gene1106. Protein 7e-43 51
CLD_2250 YP_001781933.1 DNA-binding response regulator BAC0308 Protein 4e-41 44
CLD_2250 YP_001781933.1 DNA-binding response regulator BAC0125 Protein 4e-42 43
CLD_2250 YP_001781933.1 DNA-binding response regulator NC_012469.1.7685629. Protein 2e-39 43
CLD_2250 YP_001781933.1 DNA-binding response regulator BAC0197 Protein 8e-41 43
CLD_2250 YP_001781933.1 DNA-binding response regulator NC_014475.1.orf0.gen Protein 4e-36 42
CLD_2250 YP_001781933.1 DNA-binding response regulator NC_005054.2598277.p0 Protein 4e-36 42
CLD_2250 YP_001781933.1 DNA-binding response regulator BAC0347 Protein 2e-35 41
CLD_2250 YP_001781933.1 DNA-binding response regulator NC_012469.1.7686381. Protein 1e-33 41
CLD_2250 YP_001781933.1 DNA-binding response regulator BAC0111 Protein 1e-37 41
CLD_2250 YP_001781933.1 DNA-binding response regulator HE999704.1.gene2815. Protein 3e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLD_2250 YP_001781933.1 DNA-binding response regulator VFG0596 Protein 1e-38 41
CLD_2250 YP_001781933.1 DNA-binding response regulator VFG1390 Protein 2e-39 41