Gene Information

Name : CBF_2363 (CBF_2363)
Accession : YP_005675226.1
Strain : Clostridium botulinum 230613
Genome accession: NC_017297
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2517801 - 2518481 bp
Length : 681 bp
Strand : -
Note : identified by match to protein family HMM PF00072; match to protein family HMM PF00486

DNA sequence :
ATGGTTAAGATTTTAATAGTTGAAGATGAAGAGAAATTATCAAGATTTATTGAGCTTGAGTTAAAACACGAAGGGTATGA
AATAGTAAAAGCAAATAATGGTAGAACTGGTCTTGAAATTGCAGAAAAAGGTGAGGCTGATTTAGTTCTTCTTGATATAA
TGCTTCCAGAAATAAACGGTCTTGAAGTATTAAGAAGGCTTAGAAGAACTTCTGATATTCCAATTATAATGCTTACTGCA
AGAGATGCAGTTATGGATAAAGTATCAGGTCTTGATGCAGGAGCAGATGATTATATAACTAAGCCATTTGCAATAGAAGA
GTTACTTGCAAGAATAAGAACAGCCCTTAAAAAGAGAATAGTTACAGTGAAGAAAGATGAAGATATAATAAGATGTGGCT
TATTGTCATTAGATAAAATGAGACATAAAGTAATGTATGATAGCACAGAGATAGAACTAACCAATAGAGAGTTTAATTTG
TTACAAATATTAATGGAAAACAAGAATATAGTGTTAACCAGAAGTATACTTATGGAAAAGGTATGTGGTTATGATTATCT
TGGAGAAACCAATGTTATAGATGTTTATATAAGGTTTTTGAGAACAAAAATAGATGATGCTTTTAAGGTTAAAATAATAA
CTACAGTTCGTGGTGTAGGATACGTAATTAAAGATGAGTAG

Protein sequence :
MVKILIVEDEEKLSRFIELELKHEGYEIVKANNGRTGLEIAEKGEADLVLLDIMLPEINGLEVLRRLRRTSDIPIIMLTA
RDAVMDKVSGLDAGADDYITKPFAIEELLARIRTALKKRIVTVKKDEDIIRCGLLSLDKMRHKVMYDSTEIELTNREFNL
LQILMENKNIVLTRSILMEKVCGYDYLGETNVIDVYIRFLRTKIDDAFKVKIITTVRGVGYVIKDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CBF_2363 YP_005675226.1 DNA-binding response regulator HE999704.1.gene1528. Protein 2e-47 56
CBF_2363 YP_005675226.1 DNA-binding response regulator NC_007793.3914065.p0 Protein 8e-47 51
CBF_2363 YP_005675226.1 DNA-binding response regulator NC_007622.3794948.p0 Protein 8e-47 51
CBF_2363 YP_005675226.1 DNA-binding response regulator NC_002951.3238224.p0 Protein 8e-47 51
CBF_2363 YP_005675226.1 DNA-binding response regulator NC_002952.2859858.p0 Protein 8e-47 51
CBF_2363 YP_005675226.1 DNA-binding response regulator NC_013450.8614146.p0 Protein 8e-47 51
CBF_2363 YP_005675226.1 DNA-binding response regulator NC_010079.5776364.p0 Protein 8e-47 51
CBF_2363 YP_005675226.1 DNA-binding response regulator NC_003923.1003417.p0 Protein 8e-47 51
CBF_2363 YP_005675226.1 DNA-binding response regulator NC_002758.1121390.p0 Protein 8e-47 51
CBF_2363 YP_005675226.1 DNA-binding response regulator AE015929.1.gene1106. Protein 7e-43 51
CBF_2363 YP_005675226.1 DNA-binding response regulator BAC0308 Protein 4e-41 44
CBF_2363 YP_005675226.1 DNA-binding response regulator BAC0125 Protein 4e-42 43
CBF_2363 YP_005675226.1 DNA-binding response regulator NC_012469.1.7685629. Protein 2e-39 43
CBF_2363 YP_005675226.1 DNA-binding response regulator BAC0197 Protein 8e-41 43
CBF_2363 YP_005675226.1 DNA-binding response regulator NC_014475.1.orf0.gen Protein 4e-36 42
CBF_2363 YP_005675226.1 DNA-binding response regulator NC_005054.2598277.p0 Protein 4e-36 42
CBF_2363 YP_005675226.1 DNA-binding response regulator BAC0347 Protein 2e-35 41
CBF_2363 YP_005675226.1 DNA-binding response regulator NC_012469.1.7686381. Protein 1e-33 41
CBF_2363 YP_005675226.1 DNA-binding response regulator BAC0111 Protein 1e-37 41
CBF_2363 YP_005675226.1 DNA-binding response regulator HE999704.1.gene2815. Protein 3e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CBF_2363 YP_005675226.1 DNA-binding response regulator VFG0596 Protein 1e-38 41
CBF_2363 YP_005675226.1 DNA-binding response regulator VFG1390 Protein 2e-39 41