Gene Information

Name : Dda3937_00228 (Dda3937_00228)
Accession : YP_003881005.1
Strain : Dickeya dadantii 3937
Genome accession: NC_014500
Putative virulence/resistance : Virulence
Product : DNA-binding heavy metal response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 261875 - 262546 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGCGTATTCTGGTGATTGAAGACGATGCGGGCACCGGGGATTACCTGAAAAAGGGGCTGACCGAGGCGGGATATGCGGT
TGATCTGGCGCGCAACGGCACGGACGGGTTGTTCAATGCGCTGGAACACGGCTACGACGCTATCATTCTGGATGTGATGT
TACCGGGCCTCAATGGCTGGCAGATTATTGAGATGCTGCGCAAGAAAAGCGACGTGCCGGTGCTGTTTCTGACGGCGCGC
GACCAGTTGCACGACCGCATTCACGGGCTGGAACTGGGCGCGGACGACTACCTGATCAAACCTTTTTCTTTTACCGAACT
GGTGCTGCGCATGCGCACCCTGTTGCGTCGCGGCGCGGTGCGTGAGGCGGATCACTACGTGGTAGCGGATTTGCAACTGG
ATGTGCTGCGGCGCAAAGCCACACGTCAGGATACGGCCATTCCGCTGACCAACAAGGAATTCATGTTGCTGCATTTGCTG
GTGCGGCGCGAAGGCGAAGTGTTGTCCCGCACCTTGATCGCTTCGCAGGTGTGGGATATGAATTTCGACAGCGACACCAA
TGTGGTGGATGTGGCGGTAAAACGCCTGCGCGCCAAAATCGACAAGCCGTTTGACGTCAAGTTGATCCATACCGTGCGCG
GTATTGGCTATGTGTGCGAGCCGCGTTCATGA

Protein sequence :
MRILVIEDDAGTGDYLKKGLTEAGYAVDLARNGTDGLFNALEHGYDAIILDVMLPGLNGWQIIEMLRKKSDVPVLFLTAR
DQLHDRIHGLELGADDYLIKPFSFTELVLRMRTLLRRGAVREADHYVVADLQLDVLRRKATRQDTAIPLTNKEFMLLHLL
VRREGEVLSRTLIASQVWDMNFDSDTNVVDVAVKRLRAKIDKPFDVKLIHTVRGIGYVCEPRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-55 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-54 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator BAC0197 Protein 4e-67 63
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator BAC0125 Protein 2e-66 62
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator BAC0308 Protein 7e-62 61
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator BAC0638 Protein 4e-57 61
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator BAC0083 Protein 2e-63 60
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator BAC0111 Protein 2e-62 60
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator BAC0347 Protein 1e-53 55
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator NC_007793.3914065.p0 Protein 6e-37 42
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator NC_007622.3794948.p0 Protein 6e-37 42
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator NC_002951.3238224.p0 Protein 6e-37 42
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator NC_002952.2859858.p0 Protein 6e-37 42
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator NC_013450.8614146.p0 Protein 6e-37 42
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator NC_010079.5776364.p0 Protein 6e-37 42
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator NC_003923.1003417.p0 Protein 6e-37 42
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator NC_002758.1121390.p0 Protein 6e-37 42
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator AE000516.2.gene3505. Protein 6e-30 42
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator Y16952.3.orf35.gene. Protein 9e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator VFG0596 Protein 9e-56 54
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator VFG1390 Protein 2e-39 43
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator VFG1386 Protein 7e-35 43
Dda3937_00228 YP_003881005.1 DNA-binding heavy metal response regulator VFG1389 Protein 1e-34 43