Gene Information

Name : SSON53_11990 (SSON53_11990)
Accession : YP_005456932.1
Strain : Shigella sonnei 53G
Genome accession: NC_016822
Putative virulence/resistance : Virulence
Product : 2-component sensor protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2213380 - 2214738 bp
Length : 1359 bp
Strand : -
Note : COG0642 Signal transduction histidine kinase

DNA sequence :
ATGAAAAGATTATCTATAACCGTCCGTTTAACCTTGCTTTTTATATTGCTGCTGTCTGTTGCTGGCGCTGGAATTGTCTG
GACTCTCTATAATGGCCTGGCAAGTGAGTTGAAATGGCGCGATGATACAACACTCATTAACCGGACAGCACAGATCAAGC
AGTTGTTAATTGATGGGGTAAATCCAGATACGTTACCTGTATACTTTAACCGGATGATGGATGTTAGTCAGGATATCTTG
ATCATTCATGGTGATGGCATCAATAAAATTGTTAACCGGACAAATGTCAGTGATGACATGTTAAATAACATACCTGCTAG
TGAGACAATCAGCGCAGCTGGCATTTACAGAAGCATTATTAATGATACTGAGATTGATGCTTTACGAATTAATATTGATG
AAGTTTCGCCATCATTAACGGTTACTGTGGCTAAATTGGCTTCAGCCAGACATAACATGCTTGAACAGTATAAAATTAAT
AGCATTATAATTTGCATTGTCGCCATTGTACTTTGCTCAGTATTAAGTCCGCTGTTAATCAGAACGGGATTACGAGAGAT
CAAAAAGTTGAGTGGTGTAACGGAAGCGCTGAATTATAACGATAGCCGGGAGCCTGTTGAGGTTAGCGCATTACCGAGAG
AACTAAAACCTCTTGGGCAGGCGTTGAATAAAATGCATCATGCTTTAGTCAAAGATTTTGAGCGTCTAAGTCAATTTGCT
GACGATCTCGCTCATGAACTTAGAACGCCCATTAATGCATTACTGGGTCAGAATCAGGTTACGCTCAGTCAAACCAGAAG
TATCGCTGAATATCAAAAAACAATTGCCGGTAACATTGAAGAGCTGGAAAATATTTCGCGGTTAACAGAGAACATACTGT
TTCTTGCCCGGGCAGATAAAAACAATGTTTTGGTGAAACTGGACTCGCTTTCTCTCAATAAGGAAGTCGAAAATTTGTTG
GATTATCTTGAATACCTTTCAGACGAGAAAGAGATTTGCTTTAAGGTCGAGTGCAATCAGCAAATCTTTGCGGATAAAAT
TTTACTGCAACGAATGTTATCGAATCTTATTGTTAATGCCATTAGATATTCACCAGAAAAATCGCGTATTCATATAACCA
GTTTTCTTGATACCAACGGCTATCTTAATATTGATGTCGCCAGTCCTGGAACGAAAATTCATGAGCCTGAAAAACTCTTC
CGTAGATTTTGGCGGGGAGATAATTCGCGTCATTCCGTAGGTCAGGGACTTGGTCTTTCTTTAGTCAAAGCGATTGCCGA
ATTACATGGGGGAAGTGCTACGTATCACTATCTCAATAAGCATAATGTGTTCCGGATTATGTTACCGCAAAGAAATTAA

Protein sequence :
MKRLSITVRLTLLFILLLSVAGAGIVWTLYNGLASELKWRDDTTLINRTAQIKQLLIDGVNPDTLPVYFNRMMDVSQDIL
IIHGDGINKIVNRTNVSDDMLNNIPASETISAAGIYRSIINDTEIDALRINIDEVSPSLTVTVAKLASARHNMLEQYKIN
SIIICIVAIVLCSVLSPLLIRTGLREIKKLSGVTEALNYNDSREPVEVSALPRELKPLGQALNKMHHALVKDFERLSQFA
DDLAHELRTPINALLGQNQVTLSQTRSIAEYQKTIAGNIEELENISRLTENILFLARADKNNVLVKLDSLSLNKEVENLL
DYLEYLSDEKEICFKVECNQQIFADKILLQRMLSNLIVNAIRYSPEKSRIHITSFLDTNGYLNIDVASPGTKIHEPEKLF
RRFWRGDNSRHSVGQGLGLSLVKAIAELHGGSATYHYLNKHNVFRIMLPQRN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copS AAC33720.1 histidine kinase Not tested SPI-5 Protein 8e-107 55
copS NP_460068.1 copper resistance protein Not tested SPI-5 Protein 2e-110 55

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SSON53_11990 YP_005456932.1 2-component sensor protein VFG0595 Protein 6e-111 55