Gene Information

Name : H681_11850 (H681_11850)
Accession : YP_007657780.1
Strain : Pseudomonas denitrificans ATCC 13867
Genome accession: NC_020829
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2621750 - 2622424 bp
Length : 675 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAGATCCTACTCATCGAGGACGACCACAAGACGGCCGACTATCTGCAACAGGGGCTAACTGAAAGCGGCTATGTGGT
CGACCGCGCCGACAACGGTGTCGACGGCCTGCACCTTGCCCGGCAGTGCGCCTACGATCTGTTGATCCTCGACGTGAACC
TGCCGCAGATGGACGGCTGGGAGGTGCTGGCCAGCCTGCGCCAGCAGAGCGACATGCGGGTGATGATGCTGACCGCGCGC
GGCCGCCTCACCGAGCGCGTCAAGGGCTTCGACCTGGGCGCCGACGACTACCTGCTCAAGCCCTTCGAGTTTCCCGAGCT
GCTGGCTCGCGTCCGCTCGCTGCTGCGTCGCAGCGAGCGCATCGAGCAACCCCAGGTGCTGCAGATCGGCGGACTGGAAC
TCGACCCCGGCCGCCACCGGGCCTACCGCGACAGCCAGCGCATCGACCTGACCAGCAAGGAGTTCGCCCTGCTCCACCTG
CTGATGAGCCGCAGCGGTGAAGTGCTCTCGCGCACCCAGATCATCTCGCTGGTGTGGGACATGAACTTCGACTGCGACAC
CAACGTGGTGGAAGTCACCATCCGCCGCCTGCGGGCAAAGATCGACGATCCCTTCGCCGACAAGCTGATCCATACCCTGC
GCGGCGTCGGCTACGTGCTCGAAACACGCCCATGA

Protein sequence :
MKILLIEDDHKTADYLQQGLTESGYVVDRADNGVDGLHLARQCAYDLLILDVNLPQMDGWEVLASLRQQSDMRVMMLTAR
GRLTERVKGFDLGADDYLLKPFEFPELLARVRSLLRRSERIEQPQVLQIGGLELDPGRHRAYRDSQRIDLTSKEFALLHL
LMSRSGEVLSRTQIISLVWDMNFDCDTNVVEVTIRRLRAKIDDPFADKLIHTLRGVGYVLETRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-49 55
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-50 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator BAC0083 Protein 8e-53 59
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator BAC0125 Protein 4e-59 59
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator BAC0638 Protein 3e-47 58
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator BAC0308 Protein 2e-51 54
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator BAC0197 Protein 4e-56 54
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator BAC0111 Protein 3e-52 53
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator BAC0347 Protein 1e-47 52
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 8e-28 42
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 3e-30 41
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 3e-30 41
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 3e-30 41
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 3e-30 41
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 3e-30 41
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 3e-30 41
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 3e-30 41
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 3e-30 41
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator CP000034.1.gene3834. Protein 2e-18 41
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator NC_002695.1.915041.p Protein 2e-18 41
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator NC_012469.1.7685629. Protein 2e-26 41
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator U82965.2.orf14.gene. Protein 6e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator VFG0596 Protein 1e-50 52
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator VFG1390 Protein 1e-31 42
H681_11850 YP_007657780.1 two component heavy metal response transcriptional regulator VFG1389 Protein 2e-29 42