Gene Information

Name : SPAB_02460 (SPAB_02460)
Accession : YP_001588674.1
Strain : Salmonella enterica SGSC4150; SPB7
Genome accession: NC_010102
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0642
EC number : -
Position : 2024395 - 2025759 bp
Length : 1365 bp
Strand : +
Note : KEGG: sec:SC1045 1.0e-234 copS; copper resistance; histidine kinase K07644; COG: COG0642 Signal transduction histidine kinase; Psort location: endoplasmic reticulum, score: 9

DNA sequence :
ATGGTTAAGTTATCAATGACGCTGCGCCTGACAATTTCTTTTATCGCCATCCTTATCCTCGCCTGTACCGGCATTAGCTG
GACGCTCTATAACGCGCTGAGCAAAGAATTAACGTATCGTGATGATATGACGCTAATAAATCGGGCGGCGCAAATGCAGC
AACTGTTACTGGATGGCGCCAGGCCGGAAAATCTGCCGCTCTATTTCAATCGGATGGTGGATACGAAGCAGGATATCTTA
TTGATCCATTCAGCAACAGGCCACAATGTTGCGATTAATCATAGCGGCATCCCCGACCAACGCTTTAACGAGATTCCGCT
GGCTAAAAACATCACCCGCGAAACCTTATTTCGCCAGGCGGTACAAGGCACGGAACTTACCGCGGTACGAGTAAACGCCA
GAAGCGGCGATGACCCGCTGACCCTTACTATTGCCAGGCTGGCGACGGAAAGGCGGCAAATGCTGACGCAATATCGCCGC
AACAGTTTGCTGATGAGCCTTATCGCGATCCTCGTCTGTTCGGCGCTCAGTCCATTAGTCATCAGAAACGGGCTGCGGGC
CATTACGTCGCTCAGCCGACTCACCGCGGCGACAGATAGCGGCACACTTCGCCAGCCGTTGGCGGAACAGGCGTTACCCG
TTGAGCTCAGGCCGCTTGGACAAGCGCTAAATACCATGCGCCAGAAGCTTTCCGACGATTTTGAACGCCTGAACCAATTT
GCCGACGATCTGGCGCATGAGCTGCGCACGCCGGTTAATATTTTACTGGGGAAGAATCAGGTGATGCTGAGTCAGGAACG
CAGCGCCGAAGAGTATCAACAAGCCCTTGTCGATAATATTGAAGAGCTGGAGGGACTGTCGCGACTGACAGAAAATATTC
TCTTTCTGGCACGCGCGGAGCACCAGAATATAGCGGTAAAAAAACAGCCTGTTTCGCTCAATGCGCTGGTCGAAAATATG
CTGGATTATCTTAGCCCCCTTGCCGAGGAGAAGCGCATCTGTTTTATAAATCAATGTCAGGGAACGGTATGGGCTGACGA
AATATTATTACAAAGAGTGCTCTCAAACCTGCTGACGAATGCCATCCGTTATTCTGATGAAAACGCCGTGATACGTATTG
AAAGCGCTTATGATGATAACGTTGCAGAAATTCGGGTCGCTAATCCGGGCAGCCACCCAGCCGATGCGGATAAGCTTTTC
CGGCGTTTTTGGCGAGGAGATAATGCCCGCCACACTGCCGGTTTCGGCCTGGGGTTATCGTTAGTTAACGCGATTGCTCT
ATTACACGGTGGTTCGGCATCTTACCGCTATGCCGATGAACATAATATCTTTTCGGTTCGTCTGCCCGATAGCGGTGATA
GCTAA

Protein sequence :
MVKLSMTLRLTISFIAILILACTGISWTLYNALSKELTYRDDMTLINRAAQMQQLLLDGARPENLPLYFNRMVDTKQDIL
LIHSATGHNVAINHSGIPDQRFNEIPLAKNITRETLFRQAVQGTELTAVRVNARSGDDPLTLTIARLATERRQMLTQYRR
NSLLMSLIAILVCSALSPLVIRNGLRAITSLSRLTAATDSGTLRQPLAEQALPVELRPLGQALNTMRQKLSDDFERLNQF
ADDLAHELRTPVNILLGKNQVMLSQERSAEEYQQALVDNIEELEGLSRLTENILFLARAEHQNIAVKKQPVSLNALVENM
LDYLSPLAEEKRICFINQCQGTVWADEILLQRVLSNLLTNAIRYSDENAVIRIESAYDDNVAEIRVANPGSHPADADKLF
RRFWRGDNARHTAGFGLGLSLVNAIALLHGGSASYRYADEHNIFSVRLPDSGDS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copS AAC33720.1 histidine kinase Not tested SPI-5 Protein 0.0 99
copS NP_460068.1 copper resistance protein Not tested SPI-5 Protein 0.0 99

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SPAB_02460 YP_001588674.1 hypothetical protein VFG0595 Protein 0.0 99