Gene Information

Name : H045_12115 (H045_12115)
Accession : YP_007397984.1
Strain : Pseudomonas poae RE*1-1-14
Genome accession: NC_020209
Putative virulence/resistance : Virulence
Product : response regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2792099 - 2792770 bp
Length : 672 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAACATCCTTGTTGTCGAAGACGAACCCAAGGCAGGCAATTACCTGCTCAACGGCTTGCAGGAATTGGGGTATTGCGT
GAGCCTCGCGCGCGACGGTGTGGACGGTTTGCACCAAGCGCTGGAAACGCCTTTCGACGTGATAGTGCTGGATGTGATGA
TGCCGAAAATGGATGGCTGGGAAGTACTGCGGCGCCTGCGCAAGGAAGCGGACACGCCCGTGCTGTTCCTGACCGCCCGC
GACGACATCGCAGACCGCATCAAGGGCTTGGAACTGGGCGCCGATGACTACCTGATCAAGCCTTTCTCGTTCGCCGAACT
GGTCGCACGCCTGCGCACCCTGACACGGCGAGGCCCGATCCGCGAAGATGAACAGTTGCAGATTGCCGACCTGCAAATCG
ACGTGCTCAAGCGCCGCGTCACCCGCGCCGACACGCGGATCACCTTGACCAATAAGGAATTCGCCCTGCTGCACCTGTTT
GCAGCCCACCATGGCCAGGTGCTGTCGCGCTCGCTGATCGCCTCGCGGGTGTGGGACATGAATTTCGACAGCGACACCAA
TGTGGTCGACGTGGCCGTGCGGCGTCTGCGCCTGAAAATCGATGACCCGTTCCAGCTCAAACTGATCCACAGCGTACGTG
GCATTGGCTACCGCTTCGATACCCAGCCATGA

Protein sequence :
MNILVVEDEPKAGNYLLNGLQELGYCVSLARDGVDGLHQALETPFDVIVLDVMMPKMDGWEVLRRLRKEADTPVLFLTAR
DDIADRIKGLELGADDYLIKPFSFAELVARLRTLTRRGPIREDEQLQIADLQIDVLKRRVTRADTRITLTNKEFALLHLF
AAHHGQVLSRSLIASRVWDMNFDSDTNVVDVAVRRLRLKIDDPFQLKLIHSVRGIGYRFDTQP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-55 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-54 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H045_12115 YP_007397984.1 response regulatory protein BAC0125 Protein 7e-67 63
H045_12115 YP_007397984.1 response regulatory protein BAC0083 Protein 7e-67 61
H045_12115 YP_007397984.1 response regulatory protein BAC0197 Protein 2e-64 60
H045_12115 YP_007397984.1 response regulatory protein BAC0638 Protein 2e-59 60
H045_12115 YP_007397984.1 response regulatory protein BAC0111 Protein 6e-64 57
H045_12115 YP_007397984.1 response regulatory protein BAC0308 Protein 1e-57 57
H045_12115 YP_007397984.1 response regulatory protein BAC0347 Protein 1e-56 52
H045_12115 YP_007397984.1 response regulatory protein HE999704.1.gene2815. Protein 4e-31 42
H045_12115 YP_007397984.1 response regulatory protein NC_003923.1003417.p0 Protein 1e-36 41
H045_12115 YP_007397984.1 response regulatory protein NC_013450.8614146.p0 Protein 1e-36 41
H045_12115 YP_007397984.1 response regulatory protein NC_002951.3238224.p0 Protein 1e-36 41
H045_12115 YP_007397984.1 response regulatory protein NC_007793.3914065.p0 Protein 1e-36 41
H045_12115 YP_007397984.1 response regulatory protein NC_002758.1121390.p0 Protein 1e-36 41
H045_12115 YP_007397984.1 response regulatory protein NC_010079.5776364.p0 Protein 1e-36 41
H045_12115 YP_007397984.1 response regulatory protein NC_002952.2859858.p0 Protein 1e-36 41
H045_12115 YP_007397984.1 response regulatory protein NC_007622.3794948.p0 Protein 1e-36 41
H045_12115 YP_007397984.1 response regulatory protein AE016830.1.gene1681. Protein 1e-34 41
H045_12115 YP_007397984.1 response regulatory protein AE000516.2.gene3505. Protein 5e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
H045_12115 YP_007397984.1 response regulatory protein VFG0596 Protein 2e-55 53
H045_12115 YP_007397984.1 response regulatory protein VFG1390 Protein 8e-40 45
H045_12115 YP_007397984.1 response regulatory protein VFG1386 Protein 1e-37 45
H045_12115 YP_007397984.1 response regulatory protein VFG1389 Protein 3e-33 43