Gene Information

Name : AZOBR_150105 (AZOBR_150105)
Accession : YP_005032067.1
Strain : Azospirillum brasilense Sp245
Genome accession: NC_016617
Putative virulence/resistance : Virulence
Product : two-component transcriptional regulator involved in heavy-metal (Cu/Zn) homeostasis
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2272863 - 2273546 bp
Length : 684 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 11004187, 11399769; Product type r : regulator

DNA sequence :
ATGCTCATGAAAGTCCTCGTCATCGAAGACGACCAGCAGGCCGCCTCCTATCTGGCCAAGGGGCTGAAGGAGGCCGGGCA
TGTCGTGGACGCCGCCAACGACGGCAAGGAGGGGCTGTTCCTGGCCGGCTCCGAGCATTACGACGTCATGATCGTCGACC
GCATGCTGCCGGGCCGCGACGGGCTGTCGCTGGTCGAGATCCTGCGCGCCACCGGCAACGACACGCCGGTGCTGTTCCTC
TCCGCGCTGGGCAGCGTCGACGACCGGGTGAAGGGGCTGAAGGCCGGCGGCGACGACTACCTGACCAAGCCCTTCGCCTT
CTCCGAGCTGCTTGCCCGGATCGAGGTGCTGGTGCGCCGCCGCAGCGCCGCCCAGCCGCAGACCCGCCTGGCGGTCGCCG
ACTTGGAGCTGGACCTGCTGTCGCGCACCGTCCGGCGGGCCGGCAAGTCCATCGACCTGCTGCCACGGGAATTCGCCCTG
CTGGAGTATCTGATGCGCAACGCCGGCAGCGTGGTGACCCGCACCATGATGCTGGAGAATGTGTGGGACTATCACTTCGA
CCCGCAGACCAACGTCATCGACGTGCACATCGCACGCCTGCGGCAGAAGATCGACAAGGATTTCCCCACGCCGCTGATCC
ACACGGTGCGCGGCGCCGGCTACAGCCTGCGGGCGCCGCAATGA

Protein sequence :
MLMKVLVIEDDQQAASYLAKGLKEAGHVVDAANDGKEGLFLAGSEHYDVMIVDRMLPGRDGLSLVEILRATGNDTPVLFL
SALGSVDDRVKGLKAGGDDYLTKPFAFSELLARIEVLVRRRSAAQPQTRLAVADLELDLLSRTVRRAGKSIDLLPREFAL
LEYLMRNAGSVVTRTMMLENVWDYHFDPQTNVIDVHIARLRQKIDKDFPTPLIHTVRGAGYSLRAPQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-47 50
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-46 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AZOBR_150105 YP_005032067.1 two-component transcriptional regulator involved in heavy-metal (Cu/Zn) homeostasis BAC0638 Protein 1e-48 54
AZOBR_150105 YP_005032067.1 two-component transcriptional regulator involved in heavy-metal (Cu/Zn) homeostasis BAC0083 Protein 1e-53 52
AZOBR_150105 YP_005032067.1 two-component transcriptional regulator involved in heavy-metal (Cu/Zn) homeostasis BAC0125 Protein 3e-53 52
AZOBR_150105 YP_005032067.1 two-component transcriptional regulator involved in heavy-metal (Cu/Zn) homeostasis BAC0347 Protein 6e-53 50
AZOBR_150105 YP_005032067.1 two-component transcriptional regulator involved in heavy-metal (Cu/Zn) homeostasis BAC0111 Protein 1e-56 50
AZOBR_150105 YP_005032067.1 two-component transcriptional regulator involved in heavy-metal (Cu/Zn) homeostasis BAC0197 Protein 1e-48 50
AZOBR_150105 YP_005032067.1 two-component transcriptional regulator involved in heavy-metal (Cu/Zn) homeostasis BAC0308 Protein 3e-50 48
AZOBR_150105 YP_005032067.1 two-component transcriptional regulator involved in heavy-metal (Cu/Zn) homeostasis BAC0487 Protein 2e-32 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AZOBR_150105 YP_005032067.1 two-component transcriptional regulator involved in heavy-metal (Cu/Zn) homeostasis VFG0596 Protein 3e-47 50
AZOBR_150105 YP_005032067.1 two-component transcriptional regulator involved in heavy-metal (Cu/Zn) homeostasis VFG1389 Protein 1e-37 45
AZOBR_150105 YP_005032067.1 two-component transcriptional regulator involved in heavy-metal (Cu/Zn) homeostasis VFG1390 Protein 3e-41 44
AZOBR_150105 YP_005032067.1 two-component transcriptional regulator involved in heavy-metal (Cu/Zn) homeostasis VFG1386 Protein 5e-40 42