Gene Information

Name : PPSC2_c2438 (PPSC2_c2438)
Accession : YP_003946651.1
Strain : Paenibacillus polymyxa SC2
Genome accession: NC_014622
Putative virulence/resistance : Virulence
Product : alkaline phosphatase synthesis transcriptional regulatory protein phop
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2535680 - 2536393 bp
Length : 714 bp
Strand : +
Note : -

DNA sequence :
ATGGATAAGTCGGTGCTGGTCATTGATGATGAAGAGAAGATATCCAGATTGCTTCAGTTGGAGTTATCCCATGAAGGATA
TGTGGTTGAAATCGCACAAACGGGAAGAGAAGGGTTGGAAAAAGCATTAGCCCATACATGGGATATTATTATCCTGGATG
TGATGCTGCCGGAGATAAACGGAGTTGAGGTGCTGAAGCAGATTCGAAAAGTGGACAATCATACCCCGATAATTATGGTC
ACTGCACGTAACACGACTCCTGACAAGGTCTCAGGTCTGGATGAAGGAGCTAATGATTACATTACAAAGCCTTTTGAAAT
TGAGGAGTTATTAGCGCGGATGCGGGCTAGTATGAGGAATCAATTGGAGCCGGCAGCTACCGCTTCACCAAAAGAGGACA
AGCAGCAATCCAAACTTCAGGTCGATAGCCTGGTGTTGGAACCCAAGACGCGATCTGTGGTGAGGGAAGGAAAACGTATC
GAACTTACGCCCAAAGAATTTGATCTGCTTCTTTATCTGATGGAGCACAAAAATCAGGTATTGCATCGGGACCAAATGAT
TCAGGACGTGTGGGGGTTTGATTTTGTTGGTGATACGAATGTAGTAGATGTTTATATCCGATATGTTCGCAAAAAAATTG
ATCATGGATACAAAAAGAAACTGATTAAAACCGTGCGCGGCGTTGGGTACTGTATCCGGGAGGAAGACCATTGA

Protein sequence :
MDKSVLVIDDEEKISRLLQLELSHEGYVVEIAQTGREGLEKALAHTWDIIILDVMLPEINGVEVLKQIRKVDNHTPIIMV
TARNTTPDKVSGLDEGANDYITKPFEIEELLARMRASMRNQLEPAATASPKEDKQQSKLQVDSLVLEPKTRSVVREGKRI
ELTPKEFDLLLYLMEHKNQVLHRDQMIQDVWGFDFVGDTNVVDVYIRYVRKKIDHGYKKKLIKTVRGVGYCIREEDH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-42 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-42 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_007793.3914065.p0 Protein 3e-50 49
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_007622.3794948.p0 Protein 3e-50 49
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_002951.3238224.p0 Protein 3e-50 49
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_002952.2859858.p0 Protein 3e-50 49
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_013450.8614146.p0 Protein 3e-50 49
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_010079.5776364.p0 Protein 3e-50 49
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_003923.1003417.p0 Protein 3e-50 49
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_002758.1121390.p0 Protein 3e-50 49
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop AE015929.1.gene1106. Protein 2e-46 47
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop HE999704.1.gene1528. Protein 1e-48 46
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop BAC0125 Protein 2e-41 44
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_002952.2859905.p0 Protein 1e-39 44
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_003923.1003749.p0 Protein 6e-40 44
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_007793.3914279.p0 Protein 7e-40 44
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_002951.3237708.p0 Protein 7e-40 44
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_013450.8614421.p0 Protein 7e-40 44
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_009782.5559369.p0 Protein 7e-40 44
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_009641.5332272.p0 Protein 7e-40 44
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_002745.1124361.p0 Protein 7e-40 44
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_002758.1121668.p0 Protein 7e-40 44
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_007622.3794472.p0 Protein 1e-39 43
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_012469.1.7685629. Protein 3e-40 42
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop AE016830.1.gene1681. Protein 2e-45 42
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop NC_012469.1.7686381. Protein 5e-41 42
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop FJ349556.1.orf0.gene Protein 3e-36 42
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop BAC0308 Protein 9e-40 41
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop AF155139.2.orf0.gene Protein 4e-34 41
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop BAC0638 Protein 7e-37 41
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop HE999704.1.gene2815. Protein 1e-42 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop VFG1390 Protein 2e-46 42
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop VFG1389 Protein 4e-39 42
PPSC2_c2438 YP_003946651.1 alkaline phosphatase synthesis transcriptional regulatory protein phop VFG0596 Protein 9e-43 41