Gene Information

Name : CLM_2623 (CLM_2623)
Accession : YP_002804774.1
Strain : Clostridium botulinum Kyoto
Genome accession: NC_012563
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2650512 - 2651192 bp
Length : 681 bp
Strand : -
Note : identified by match to protein family HMM PF00072; match to protein family HMM PF00486

DNA sequence :
ATGGTTAAGATTTTAATAGTTGAAGATGAAGAGAAATTATCAAGATTTATTGAGCTTGAGTTAAAACACGAAGGATATGA
AATAGTAAAAGCAAATAATGGTAGAACGGGTCTTGAAATTGCAGAAAAAGGTGAGGCTGATTTAGTTCTTCTTGATATAA
TGCTTCCAGAAATAAACGGTCTTGAAGTATTAAGAAGGCTTAGAAGAACTTCTGATATTCCAATTATAATGCTAACTGCA
AGAGATGCAGTTATGGATAAAGTATCAGGTCTTGATGCAGGAGCAGATGATTATATAACTAAGCCATTTGCAATAGAAGA
GTTACTTGCAAGAATAAGAACAGCCCTTAAAAAGAGAATAGTTACAGTGAAGAAAGATGAAGATATAATAAGATGTGGCT
TATTGTCATTAGATAAAATGAGACGTAAAGTAATGTATGATAGCACAGAGATAGAACTAACCAATAGAGAGTTTAATTTG
TTACAAATATTAATGGAAAACAAGAATATAGTGTTAACCAGAAGTATACTTATGGAAAAGGTATGTGGTTATGATTATCT
TGGAGAAACCAATGTTATAGATGTTTATATAAGGTTCTTAAGAACAAAAATAGATGATGCTTTTAAGGTTAAAATAATAA
CTACAGTTCGTGGTGTAGGATACGTAATTAAAGATGAGTAG

Protein sequence :
MVKILIVEDEEKLSRFIELELKHEGYEIVKANNGRTGLEIAEKGEADLVLLDIMLPEINGLEVLRRLRRTSDIPIIMLTA
RDAVMDKVSGLDAGADDYITKPFAIEELLARIRTALKKRIVTVKKDEDIIRCGLLSLDKMRRKVMYDSTEIELTNREFNL
LQILMENKNIVLTRSILMEKVCGYDYLGETNVIDVYIRFLRTKIDDAFKVKIITTVRGVGYVIKDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLM_2623 YP_002804774.1 DNA-binding response regulator HE999704.1.gene1528. Protein 8e-48 56
CLM_2623 YP_002804774.1 DNA-binding response regulator NC_007793.3914065.p0 Protein 2e-46 51
CLM_2623 YP_002804774.1 DNA-binding response regulator NC_007622.3794948.p0 Protein 2e-46 51
CLM_2623 YP_002804774.1 DNA-binding response regulator NC_002951.3238224.p0 Protein 2e-46 51
CLM_2623 YP_002804774.1 DNA-binding response regulator NC_002952.2859858.p0 Protein 2e-46 51
CLM_2623 YP_002804774.1 DNA-binding response regulator NC_013450.8614146.p0 Protein 2e-46 51
CLM_2623 YP_002804774.1 DNA-binding response regulator NC_010079.5776364.p0 Protein 2e-46 51
CLM_2623 YP_002804774.1 DNA-binding response regulator NC_003923.1003417.p0 Protein 2e-46 51
CLM_2623 YP_002804774.1 DNA-binding response regulator NC_002758.1121390.p0 Protein 2e-46 51
CLM_2623 YP_002804774.1 DNA-binding response regulator AE015929.1.gene1106. Protein 2e-42 51
CLM_2623 YP_002804774.1 DNA-binding response regulator BAC0125 Protein 1e-42 44
CLM_2623 YP_002804774.1 DNA-binding response regulator BAC0308 Protein 1e-41 44
CLM_2623 YP_002804774.1 DNA-binding response regulator BAC0197 Protein 3e-41 44
CLM_2623 YP_002804774.1 DNA-binding response regulator NC_012469.1.7685629. Protein 2e-39 43
CLM_2623 YP_002804774.1 DNA-binding response regulator BAC0111 Protein 5e-38 42
CLM_2623 YP_002804774.1 DNA-binding response regulator BAC0347 Protein 6e-36 41
CLM_2623 YP_002804774.1 DNA-binding response regulator NC_014475.1.orf0.gen Protein 1e-35 41
CLM_2623 YP_002804774.1 DNA-binding response regulator NC_005054.2598277.p0 Protein 1e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLM_2623 YP_002804774.1 DNA-binding response regulator VFG1390 Protein 9e-40 42
CLM_2623 YP_002804774.1 DNA-binding response regulator VFG0596 Protein 2e-38 41