Gene Information

Name : CtCNB1_2500 (CtCNB1_2500)
Accession : YP_003278542.1
Strain : Comamonas testosteroni CNB-1
Genome accession: NC_013446
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2862928 - 2863611 bp
Length : 684 bp
Strand : -
Note : COG0745, OmpR, Response regulators consisting of a CheY-likereceiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAGGATTTTGATTGTTGAAGATGAGCCTAAAACAGGTGAGTACCTGCGCCAGGGATTGACCGAGGCTGGCTACATTGC
TGACCTCGTCCCAAATGGCTCAGACGGCTTACATCTGGCTTTGCAAGGGGAGTACTCCTTGGTGATCTTGGATGTTATGC
TGCCGGGCCTCAATGGTTGGCAGGTGCTCCAGTCTTTGCGTGATCGAGGACTACATATGCCGGTCCTGTTTCTTACTGCA
CGGGACCATGTCGAGGACCGTGTCAAAGGACTAGAGCTCGGCGCTGATGATTACCTGGTAAAGCCGTTTTCTTTCGCAGA
GCTACTCGCCAGAGTTCGCATTATTCTTAGACGTGGACATCCGGCCAATGAAGGTACTACTCTGACTGTTGCAGATCTCG
AGCTAGACCTGCTGCGTCGCCGCGTATCTCGCAACGGCAAACGTGTTGACCTCACAGCCAAAGAGTTCGGACTCTTGGAG
TTGCTGATGCGCCGACATGGTGAAGTGCTGCCACGTTCATTGATCGCATCGCAGGTATGGGACATGAATTTCGACAGCGA
CACCAACGTCATTGAGGTGGCCATGCGCCGTCTGCGAGCCAAAATTGATGAAGGCCACTCGATCAAACTAATCCAGACCG
TACGGGGAATGGGCTACGTGCTTGACGTTCCTGAGGAGGAATAG

Protein sequence :
MRILIVEDEPKTGEYLRQGLTEAGYIADLVPNGSDGLHLALQGEYSLVILDVMLPGLNGWQVLQSLRDRGLHMPVLFLTA
RDHVEDRVKGLELGADDYLVKPFSFAELLARVRIILRRGHPANEGTTLTVADLELDLLRRRVSRNGKRVDLTAKEFGLLE
LLMRRHGEVLPRSLIASQVWDMNFDSDTNVIEVAMRRLRAKIDEGHSIKLIQTVRGMGYVLDVPEEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-62 62
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-62 61

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator BAC0197 Protein 4e-72 71
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator BAC0638 Protein 2e-69 70
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator BAC0083 Protein 8e-75 66
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator BAC0308 Protein 7e-70 65
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator BAC0111 Protein 2e-71 63
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator BAC0347 Protein 1e-65 61
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator BAC0125 Protein 4e-69 61
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 4e-36 42
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 4e-36 42
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 4e-36 42
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 4e-36 42
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 4e-36 42
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 4e-36 42
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 4e-36 42
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 4e-36 42
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 7e-31 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator VFG0596 Protein 6e-63 62
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator VFG1390 Protein 1e-42 44
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator VFG1386 Protein 3e-38 43
CtCNB1_2500 YP_003278542.1 two component heavy metal response transcriptional regulator VFG1389 Protein 2e-35 43