Gene Information

Name : MLBr_02439 (MLBr_02439)
Accession : YP_002504210.1
Strain : Mycobacterium leprae Br4923
Genome accession: NC_011896
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2914387 - 2914983 bp
Length : 597 bp
Strand : -
Note : -

DNA sequence :
GTGGTGACCGATGGGCCAGCGGCACTAGCGGAGTTCGATCGCTCCGGGGCGGACATCGTGCTGCTGGACTTGATGCTGCC
GGGGATGTCTGGCACTGATGTGTATAAGCAGCTGCGTGTTCGTTCCAGTGTGCCGGTGATCATGGTGACTGCTCGAGACA
GTGAGATTGACAAAGTGGTCGGCCTCGAGCTGGGCGCCGACGACTATGTTACGAAACCCTATTCGGCGCGTGAATTGATC
GCCCGGATCCGGGCGGTGCTGCGGCGTGGCGGTGATGACGACTCCGAAATTAGCGATGGTGTGCTGGAGTCCGGGCCGCT
CCGGATGGATGTTGAGCGGCATGTGGTCTCGGTGAACGGCTATGCCATCACCCTGCCTCTTAAGGAATTCGATCTGCTGG
AGTACCTGATGCGCAATAGCGGGCGGGTGCTAACCCGAGGGCAGCTGATTGACCGGGTCTGGGGTGTGGATTACGTCGGC
GATACCAAGACCCTCGATGTCCACGTCAAGCGGCTGCGCTCCAAGATCGAGGCCGATCCCGCTAACCCGGTACATCTGGT
GACAGTGCGAGGTCTGGGCTACAAACTGGAGAGTTAG

Protein sequence :
MVTDGPAALAEFDRSGADIVLLDLMLPGMSGTDVYKQLRVRSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELI
ARIRAVLRRGGDDDSEISDGVLESGPLRMDVERHVVSVNGYAITLPLKEFDLLEYLMRNSGRVLTRGQLIDRVWGVDYVG
DTKTLDVHVKRLRSKIEADPANPVHLVTVRGLGYKLES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-28 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-31 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-30 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MLBr_02439 YP_002504210.1 two-component system response regulator AE000516.2.gene3505. Protein 3e-34 48
MLBr_02439 YP_002504210.1 two-component system response regulator HE999704.1.gene2815. Protein 8e-40 47
MLBr_02439 YP_002504210.1 two-component system response regulator NC_012469.1.7686381. Protein 2e-42 46
MLBr_02439 YP_002504210.1 two-component system response regulator NC_012469.1.7685629. Protein 3e-41 46
MLBr_02439 YP_002504210.1 two-component system response regulator BAC0197 Protein 1e-32 44
MLBr_02439 YP_002504210.1 two-component system response regulator NC_002952.2859905.p0 Protein 3e-39 44
MLBr_02439 YP_002504210.1 two-component system response regulator NC_009782.5559369.p0 Protein 3e-39 44
MLBr_02439 YP_002504210.1 two-component system response regulator NC_007793.3914279.p0 Protein 3e-39 44
MLBr_02439 YP_002504210.1 two-component system response regulator NC_002758.1121668.p0 Protein 3e-39 44
MLBr_02439 YP_002504210.1 two-component system response regulator NC_009641.5332272.p0 Protein 3e-39 44
MLBr_02439 YP_002504210.1 two-component system response regulator NC_013450.8614421.p0 Protein 3e-39 44
MLBr_02439 YP_002504210.1 two-component system response regulator NC_002951.3237708.p0 Protein 3e-39 44
MLBr_02439 YP_002504210.1 two-component system response regulator NC_003923.1003749.p0 Protein 3e-39 44
MLBr_02439 YP_002504210.1 two-component system response regulator NC_007622.3794472.p0 Protein 2e-39 44
MLBr_02439 YP_002504210.1 two-component system response regulator NC_002745.1124361.p0 Protein 3e-39 44
MLBr_02439 YP_002504210.1 two-component system response regulator AE016830.1.gene1681. Protein 1e-40 43
MLBr_02439 YP_002504210.1 two-component system response regulator BAC0125 Protein 2e-30 42
MLBr_02439 YP_002504210.1 two-component system response regulator BAC0111 Protein 8e-32 42
MLBr_02439 YP_002504210.1 two-component system response regulator HE999704.1.gene1528. Protein 8e-26 42
MLBr_02439 YP_002504210.1 two-component system response regulator BAC0347 Protein 5e-29 41
MLBr_02439 YP_002504210.1 two-component system response regulator BAC0083 Protein 9e-33 41
MLBr_02439 YP_002504210.1 two-component system response regulator AE015929.1.gene1106. Protein 3e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MLBr_02439 YP_002504210.1 two-component system response regulator VFG1389 Protein 1e-28 42
MLBr_02439 YP_002504210.1 two-component system response regulator VFG0596 Protein 4e-29 42
MLBr_02439 YP_002504210.1 two-component system response regulator VFG1390 Protein 5e-28 41
MLBr_02439 YP_002504210.1 two-component system response regulator VFG1386 Protein 2e-30 41
MLBr_02439 YP_002504210.1 two-component system response regulator VFG1563 Protein 3e-31 41
MLBr_02439 YP_002504210.1 two-component system response regulator VFG1702 Protein 9e-31 41