Gene Information

Name : CLJ_B2614 (CLJ_B2614)
Accession : YP_002863377.1
Strain : Clostridium botulinum 657
Genome accession: NC_012658
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2577359 - 2578039 bp
Length : 681 bp
Strand : -
Note : identified by match to protein family HMM PF00072; match to protein family HMM PF00486

DNA sequence :
ATGGTTAAGATTTTAATAGTTGAAGATGAAGAGAAATTATCAAGATTTATTGAGCTTGAGTTAAAACACGAAGGGTATGA
AATAGTAAAAGCAAATAATGGTAGAACAGGTCTTGAAATTGCAGAAAAAGGTGAGATTGATTTAATTCTTCTTGATATAA
TGCTTCCAGAAATAAATGGTCTTGAAGTATTAAGAAGGCTTAGAAGAACTTCTGATATTCCAATTATAATGCTTACTGCA
AGAGATGCAGTTATGGATAAAGTATCAGGTCTTGATGCAGGAGCAGATGATTATATAACTAAGCCATTTGCAATAGAAGA
GTTACTTGCAAGAATAAGAACAGCCCTTAAAAAGAGAATAGTTACAGTGAAGAAAGATGAAGATATAATAAGATGTGGCT
TATTATCATTAGATAAAATTAGACATAAAGTAATGTATGATAGCACAGAGATAGAACTGACAAATAGAGAGTTTAATTTG
TTACAAATATTAATGGAAAACAAGAATATAGTGTTAACTAGAAGTATACTTATGGAAAAGGTATGTGGTTATGATTATCT
TGGAGAAACCAATGTTATAGATGTTTATATAAGATTTTTAAGAACAAAAATAGATGATGCATTTAAGGTTAAAATAATAA
CTACAGTTCGTGGTGTGGGATACGTAATTAAAGATGAGTAG

Protein sequence :
MVKILIVEDEEKLSRFIELELKHEGYEIVKANNGRTGLEIAEKGEIDLILLDIMLPEINGLEVLRRLRRTSDIPIIMLTA
RDAVMDKVSGLDAGADDYITKPFAIEELLARIRTALKKRIVTVKKDEDIIRCGLLSLDKIRHKVMYDSTEIELTNREFNL
LQILMENKNIVLTRSILMEKVCGYDYLGETNVIDVYIRFLRTKIDDAFKVKIITTVRGVGYVIKDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-39 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLJ_B2614 YP_002863377.1 DNA-binding response regulator HE999704.1.gene1528. Protein 2e-47 56
CLJ_B2614 YP_002863377.1 DNA-binding response regulator NC_007793.3914065.p0 Protein 4e-47 52
CLJ_B2614 YP_002863377.1 DNA-binding response regulator NC_007622.3794948.p0 Protein 4e-47 52
CLJ_B2614 YP_002863377.1 DNA-binding response regulator NC_002951.3238224.p0 Protein 4e-47 52
CLJ_B2614 YP_002863377.1 DNA-binding response regulator NC_002952.2859858.p0 Protein 4e-47 52
CLJ_B2614 YP_002863377.1 DNA-binding response regulator NC_013450.8614146.p0 Protein 4e-47 52
CLJ_B2614 YP_002863377.1 DNA-binding response regulator NC_010079.5776364.p0 Protein 4e-47 52
CLJ_B2614 YP_002863377.1 DNA-binding response regulator NC_003923.1003417.p0 Protein 4e-47 52
CLJ_B2614 YP_002863377.1 DNA-binding response regulator NC_002758.1121390.p0 Protein 4e-47 52
CLJ_B2614 YP_002863377.1 DNA-binding response regulator AE015929.1.gene1106. Protein 3e-43 51
CLJ_B2614 YP_002863377.1 DNA-binding response regulator BAC0125 Protein 2e-42 44
CLJ_B2614 YP_002863377.1 DNA-binding response regulator BAC0308 Protein 1e-41 44
CLJ_B2614 YP_002863377.1 DNA-binding response regulator NC_012469.1.7685629. Protein 4e-39 44
CLJ_B2614 YP_002863377.1 DNA-binding response regulator BAC0197 Protein 3e-41 44
CLJ_B2614 YP_002863377.1 DNA-binding response regulator NC_014475.1.orf0.gen Protein 2e-36 42
CLJ_B2614 YP_002863377.1 DNA-binding response regulator NC_005054.2598277.p0 Protein 2e-36 42
CLJ_B2614 YP_002863377.1 DNA-binding response regulator BAC0111 Protein 4e-38 42
CLJ_B2614 YP_002863377.1 DNA-binding response regulator NC_012469.1.7686381. Protein 3e-34 41
CLJ_B2614 YP_002863377.1 DNA-binding response regulator HE999704.1.gene2815. Protein 6e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLJ_B2614 YP_002863377.1 DNA-binding response regulator VFG0596 Protein 3e-39 41
CLJ_B2614 YP_002863377.1 DNA-binding response regulator VFG1390 Protein 2e-39 41