Gene Information

Name : YSA_04750 (YSA_04750)
Accession : YP_006386457.1
Strain : Pseudomonas putida ND6
Genome accession: NC_017986
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator CzrR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2579086 - 2579745 bp
Length : 660 bp
Strand : +
Note : -

DNA sequence :
GTGGAAGACGAAATTAAAACTGCCGAATATCTTCAGCAGGGCCTATCCGAAAGCGGGTATGTCGTAGATATCGTGCACAA
CGGTGTAGATGCCCTGCACTTGTTCAACACTAATGTCTATTCGTTGGTCCTTCTGGACGTGAACCTCCCCGGTATCGACG
GCTGGGACCTGCTGGAAACCATCCGTAAGACCAGCCGGGTCCGCATCATCATGCTGACCGCCCGCGGACGCATCAATGAC
AAGCTCAAGGGCTTGGACGGCGGCGCGGATGACTACCTTGTGAAGCCATTCGAATTCCCTGAACTGCTTGCTCGCATCCG
TTCGCTGCAACGCCGTGGTGATGAGTTGGTCGAGAAGAGCTCGCTGAAAATTGCGGATCTGGAACTCGACTCCGTCCGCC
ATCGCGTCTTCCGCGGTGGCACACGCATCGATCTCACCACCAAGGAATTTGCGCTTCTGCACCTGCTCATGAGCCGAACG
GGCGAAGCGCTGACTCGTTCCCAGATCATCTCGTTGGTCTGGGATATGAATTTCGATTGCGACACCAATGTCATCGATGT
AGCCATCCGGCGCTTGCGCTCGAAGATCGATGACCCGTTTGAAACCAAGCTCATTCACACGCTTCGTGGCGTTGGGTACG
TTTTTGAGGAACGCGCATGA

Protein sequence :
MEDEIKTAEYLQQGLSESGYVVDIVHNGVDALHLFNTNVYSLVLLDVNLPGIDGWDLLETIRKTSRVRIIMLTARGRIND
KLKGLDGGADDYLVKPFEFPELLARIRSLQRRGDELVEKSSLKIADLELDSVRHRVFRGGTRIDLTTKEFALLHLLMSRT
GEALTRSQIISLVWDMNFDCDTNVIDVAIRRLRSKIDDPFETKLIHTLRGVGYVFEERA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-46 52
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-46 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
YSA_04750 YP_006386457.1 DNA-binding response regulator CzrR BAC0125 Protein 6e-55 59
YSA_04750 YP_006386457.1 DNA-binding response regulator CzrR BAC0083 Protein 2e-52 57
YSA_04750 YP_006386457.1 DNA-binding response regulator CzrR BAC0197 Protein 1e-52 57
YSA_04750 YP_006386457.1 DNA-binding response regulator CzrR BAC0638 Protein 8e-48 57
YSA_04750 YP_006386457.1 DNA-binding response regulator CzrR BAC0308 Protein 2e-49 55
YSA_04750 YP_006386457.1 DNA-binding response regulator CzrR BAC0111 Protein 2e-52 55
YSA_04750 YP_006386457.1 DNA-binding response regulator CzrR BAC0347 Protein 1e-47 52
YSA_04750 YP_006386457.1 DNA-binding response regulator CzrR NC_007793.3914065.p0 Protein 9e-29 41
YSA_04750 YP_006386457.1 DNA-binding response regulator CzrR NC_007622.3794948.p0 Protein 9e-29 41
YSA_04750 YP_006386457.1 DNA-binding response regulator CzrR NC_002951.3238224.p0 Protein 9e-29 41
YSA_04750 YP_006386457.1 DNA-binding response regulator CzrR NC_002952.2859858.p0 Protein 9e-29 41
YSA_04750 YP_006386457.1 DNA-binding response regulator CzrR NC_013450.8614146.p0 Protein 9e-29 41
YSA_04750 YP_006386457.1 DNA-binding response regulator CzrR NC_010079.5776364.p0 Protein 9e-29 41
YSA_04750 YP_006386457.1 DNA-binding response regulator CzrR NC_003923.1003417.p0 Protein 9e-29 41
YSA_04750 YP_006386457.1 DNA-binding response regulator CzrR NC_002758.1121390.p0 Protein 9e-29 41
YSA_04750 YP_006386457.1 DNA-binding response regulator CzrR AE015929.1.gene1106. Protein 5e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
YSA_04750 YP_006386457.1 DNA-binding response regulator CzrR VFG0596 Protein 4e-47 52
YSA_04750 YP_006386457.1 DNA-binding response regulator CzrR VFG1390 Protein 7e-32 41
YSA_04750 YP_006386457.1 DNA-binding response regulator CzrR VFG0473 Protein 9e-23 41