Gene Information

Name : STMMW_02581 (STMMW_02581)
Accession : YP_005231337.1
Strain : Salmonella enterica D23580
Genome accession: NC_016854
Putative virulence/resistance : Unknown
Product : putative methyltransferase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 299084 - 299854 bp
Length : 771 bp
Strand : +
Note : pfam_scan;Pfam:PF08241; E()=2.3E-26;score=91.5;query49- 145;description=Methyltransf_11

DNA sequence :
ATGACAACGCATTCCCACCATGACAATGTTGAAAAGCAGTTTGGTTCACAGGCGAACGCCTATTTACATAGCGCCGTTCA
CGCAGCGGGTCGTGACTTAGCGCGGCTGGCGCAAAGGTTGTCTGATTTTTCCCACGCGAGCGTACTGGATATGGGATGTG
GGGCTGGACACGCGAGTTTTGTCGCTGCGCAACATGCCAACTCGGTCGTGGCATACGATTTATCCGCCAGCATGCTTGAG
GTTGTCGCTGGAGCGGCGGAAGAAAGACATTTAAGTAATATTACTCTCCGGCAAGGCTATGCCGAAAAACTGCCCTTTGA
AGATGCATCGTTTGAGGTGGTGATTAGCCGCTATTCCGCGCATCACTGGCACGACGTTGGTCAGGCATTGCGTGAGGTTA
ATCGTGTATTAAAGCCCGGTGGCGTGCTGATTATCATGGATGTCATGTCGCCTGGACATCCTGTACGCGATATCTGGCTG
CAAACGGTGGAGGCGTTACGCGACACGTCGCATGTCCGTAACTATTCCAGTGGCGAATGGCTGGCGATGGTCAATAACGC
GATGCTGGTAACGAATACCGTGATAACAGATCGTTTATCGCTGGAGTTTCGCTCATGGGTAACGCGGATGCGTACGCCAG
CGCCGTTGGTTGAGGCGATTCGATTATATCAGGCGAGCGCCCCGGTAGAGGTGAAGCGTTATTTTGAGTTGCAGGATGAC
GGTTCGTTTAGCAGCGATACTATCATGCTGGAAGCGCATAAAGCGGTATAG

Protein sequence :
MTTHSHHDNVEKQFGSQANAYLHSAVHAAGRDLARLAQRLSDFSHASVLDMGCGAGHASFVAAQHANSVVAYDLSASMLE
VVAGAAEERHLSNITLRQGYAEKLPFEDASFEVVISRYSAHHWHDVGQALREVNRVLKPGGVLIIMDVMSPGHPVRDIWL
QTVEALRDTSHVRNYSSGEWLAMVNNAMLVTNTVITDRLSLEFRSWVTRMRTPAPLVEAIRLYQASAPVEVKRYFELQDD
GSFSSDTIMLEAHKAV