Gene Information

Name : Rcas_2599 (Rcas_2599)
Accession : YP_001432693.1
Strain : Roseiflexus castenholzii DSM 13941
Genome accession: NC_009767
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3352007 - 3352705 bp
Length : 699 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mta:Moth_1478 two component transcriptional regulator, winged helix family

DNA sequence :
ATGCGAGTACTGATTGTTGAAGATGAACGTGCCATCGCCGGTTATATCAAACGAGGTCTTGAAGAGCAAGGTTATGCCGT
CGATGTCGCTTATGATGGTCGGGAAGCGCTTGACTGGCTGGATGCGGCGCCGTTTGATCTGGTGATCCTCGATTTGATGC
TGCCTCAGATCGATGGTCTCACCGTCTGTCGTGAATTGCGCGCTCGTGGTTTTCGTATGCCCGTGCTGATGCTAACAGCC
CGCGATTCGATTGACGACCGCGTGCGTGGTCTTGACAGTGGCGCTGATGATTATCTGGTCAAACCGTTCGCGATCCAAGA
GTTGTTAGCTCGTCTACGCGCGCTTGCGCGGCGGAGTACCGATGCGCCGAAAACGCCGGTGCTGCACATTGCCGATCTGA
TGCTTGATACTGCTACCCGTCGTGTCAGTCGTGGCGGAAAGTACATTGAATTGACCGCTAAAGAGTATGCCATACTTGAG
TGTTTAATGCGAGCATCAGGCCGACTCCTGACGCGGACAATGATTGCCGAACACGTCTGGAACTACGACACATTTAATCA
ATCGAATGTCATCGATGTCTATATTCGTAATCTGCGTCGCAAAATTGACGATCCCTTCCCGGTGAAACTCATTCAGACGG
TACGGGGGGCCGGATATCGGTTATGGTACGAAGCCGAGCACGAGCATGATCCAACGTAG

Protein sequence :
MRVLIVEDERAIAGYIKRGLEEQGYAVDVAYDGREALDWLDAAPFDLVILDLMLPQIDGLTVCRELRARGFRMPVLMLTA
RDSIDDRVRGLDSGADDYLVKPFAIQELLARLRALARRSTDAPKTPVLHIADLMLDTATRRVSRGGKYIELTAKEYAILE
CLMRASGRLLTRTMIAEHVWNYDTFNQSNVIDVYIRNLRRKIDDPFPVKLIQTVRGAGYRLWYEAEHEHDPT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-37 48
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-36 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rcas_2599 YP_001432693.1 two component transcriptional regulator BAC0083 Protein 3e-44 53
Rcas_2599 YP_001432693.1 two component transcriptional regulator BAC0125 Protein 5e-42 52
Rcas_2599 YP_001432693.1 two component transcriptional regulator BAC0638 Protein 8e-39 52
Rcas_2599 YP_001432693.1 two component transcriptional regulator BAC0197 Protein 6e-39 51
Rcas_2599 YP_001432693.1 two component transcriptional regulator BAC0308 Protein 5e-40 50
Rcas_2599 YP_001432693.1 two component transcriptional regulator BAC0347 Protein 2e-38 48
Rcas_2599 YP_001432693.1 two component transcriptional regulator BAC0111 Protein 2e-43 48
Rcas_2599 YP_001432693.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-40 46
Rcas_2599 YP_001432693.1 two component transcriptional regulator AE015929.1.gene1106. Protein 8e-34 44
Rcas_2599 YP_001432693.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-35 43
Rcas_2599 YP_001432693.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-35 43
Rcas_2599 YP_001432693.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-35 43
Rcas_2599 YP_001432693.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-35 43
Rcas_2599 YP_001432693.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-35 43
Rcas_2599 YP_001432693.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-35 43
Rcas_2599 YP_001432693.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-35 43
Rcas_2599 YP_001432693.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-35 43
Rcas_2599 YP_001432693.1 two component transcriptional regulator BAC0487 Protein 4e-25 42
Rcas_2599 YP_001432693.1 two component transcriptional regulator NC_002516.2.879194.p Protein 4e-25 42
Rcas_2599 YP_001432693.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-32 42
Rcas_2599 YP_001432693.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-32 42
Rcas_2599 YP_001432693.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-32 42
Rcas_2599 YP_001432693.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-32 42
Rcas_2599 YP_001432693.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-32 42
Rcas_2599 YP_001432693.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-32 42
Rcas_2599 YP_001432693.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-32 42
Rcas_2599 YP_001432693.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-32 42
Rcas_2599 YP_001432693.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-32 42
Rcas_2599 YP_001432693.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-32 42
Rcas_2599 YP_001432693.1 two component transcriptional regulator U82965.2.orf14.gene. Protein 3e-27 42
Rcas_2599 YP_001432693.1 two component transcriptional regulator Y16952.3.orf35.gene. Protein 6e-28 41
Rcas_2599 YP_001432693.1 two component transcriptional regulator CP001138.1.gene1939. Protein 2e-27 41
Rcas_2599 YP_001432693.1 two component transcriptional regulator AE000516.2.gene3505. Protein 4e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rcas_2599 YP_001432693.1 two component transcriptional regulator VFG0596 Protein 1e-37 48
Rcas_2599 YP_001432693.1 two component transcriptional regulator VFG1390 Protein 5e-44 46
Rcas_2599 YP_001432693.1 two component transcriptional regulator VFG1386 Protein 9e-33 42
Rcas_2599 YP_001432693.1 two component transcriptional regulator VFG0473 Protein 7e-28 41
Rcas_2599 YP_001432693.1 two component transcriptional regulator VFG0475 Protein 2e-27 41