Gene Information

Name : BJAB0715_02598 (BJAB0715_02598)
Accession : YP_008217746.1
Strain : Acinetobacter baumannii BJAB0715
Genome accession: NC_021733
Putative virulence/resistance : Virulence
Product : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2678861 - 2679532 bp
Length : 672 bp
Strand : -
Note : COG:COG0745

DNA sequence :
ATGCGTATCCTTATTATTGAAGACGAGATCAAGATCGCCACTTATTTGGTCAAAGGATTAAAAGAGTCTGGATATCAAGC
GGAGTGTGTTCACTTAGGGCTGCAAGGTTTGGAAATGCTAAAGAGAGATCAATATGACTTGCTTATTCTTGATGTCATGC
TGCCAGACATAGACGGCTGGAGCGTATTACAAGTCCTACGCCAGTTTTCAAAAATTCCGGTGATTTTTTTAACGGCGAAA
GATCAGGTGATGGATAGAGTGAAAGGTTTGGAGTTGGGAGCAGATGATTACTTGGCTAAACCCTTTTCCTATATTGAACT
GTTGGCACGCATTAAAAGTCTGTTAAGACGACAGCAATATCTGCAAGAAAATGAGTTGTCTATTAGTGATCTAAAAATGG
ATATGGTTGGTCATAAAGTATGGCGTAGTGGCAACTTAATTGAGCTGAGTAAAACCGAATTTAATTTGTTGCGTTATTTG
TTGCTCAACAAAGAGCAAATTGTGACGCGCAGACAAATTGGTTCCGAAGTTTGGAATATTAACTTTGACACCGATACCAA
CTTTATTGACGTCGCAGTACGCCGTTTACGAAGCAAAATTGATGAGGGATATGAATTAAAACTTATTCATACCATACGTG
GCTTGGGCTATAAAATTTCGGTTAGTTTATGA

Protein sequence :
MRILIIEDEIKIATYLVKGLKESGYQAECVHLGLQGLEMLKRDQYDLLILDVMLPDIDGWSVLQVLRQFSKIPVIFLTAK
DQVMDRVKGLELGADDYLAKPFSYIELLARIKSLLRRQQYLQENELSISDLKMDMVGHKVWRSGNLIELSKTEFNLLRYL
LLNKEQIVTRRQIGSEVWNINFDTDTNFIDVAVRRLRSKIDEGYELKLIHTIRGLGYKISVSL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-49 50
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-48 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BJAB0715_02598 YP_008217746.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein BAC0308 Protein 4e-52 55
BJAB0715_02598 YP_008217746.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein BAC0197 Protein 4e-57 54
BJAB0715_02598 YP_008217746.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein BAC0125 Protein 9e-57 52
BJAB0715_02598 YP_008217746.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein BAC0111 Protein 7e-55 50
BJAB0715_02598 YP_008217746.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein BAC0083 Protein 7e-54 50
BJAB0715_02598 YP_008217746.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein BAC0638 Protein 7e-50 50
BJAB0715_02598 YP_008217746.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein BAC0347 Protein 4e-51 48
BJAB0715_02598 YP_008217746.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein NC_013450.8614146.p0 Protein 3e-34 43
BJAB0715_02598 YP_008217746.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein NC_002951.3238224.p0 Protein 3e-34 43
BJAB0715_02598 YP_008217746.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein NC_007793.3914065.p0 Protein 3e-34 43
BJAB0715_02598 YP_008217746.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein NC_002758.1121390.p0 Protein 3e-34 43
BJAB0715_02598 YP_008217746.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein NC_010079.5776364.p0 Protein 3e-34 43
BJAB0715_02598 YP_008217746.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein NC_002952.2859858.p0 Protein 3e-34 43
BJAB0715_02598 YP_008217746.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein NC_007622.3794948.p0 Protein 3e-34 43
BJAB0715_02598 YP_008217746.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein NC_003923.1003417.p0 Protein 3e-34 43
BJAB0715_02598 YP_008217746.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein AE015929.1.gene1106. Protein 5e-29 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BJAB0715_02598 YP_008217746.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein VFG0596 Protein 1e-49 50
BJAB0715_02598 YP_008217746.1 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain protein VFG1390 Protein 4e-37 43