Gene Information

Name : STMUK_0274 (STMUK_0274)
Accession : YP_005250834.1
Strain : Salmonella enterica UK-1
Genome accession: NC_016863
Putative virulence/resistance : Virulence
Product : putative chaperone ATPase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 311183 - 313822 bp
Length : 2640 bp
Strand : +
Note : similar to Escherichia coli ATP-binding component of serine protease (AAC73969.1); similar to Yersinia clpB

DNA sequence :
ATGGAAACTCCTGTTTCACGCAGTGCGTTGTATGGAAAACTGGCCGGCCCACTATTCCGGTCGCTGGAATCGGCAACGGC
ATTTTGCAAACTACGCTCTAATCCCTGGGTTGAGCTGACTCACTGGCTGCACCAGTTAACACAGCAGCCCGATAACGATA
TTCTCCACGTTCTTCGGCATTACCAGATCCCTCTTTCTGATGTGGAGAAAGCGTTACTCCGGCAACTGGATATGCTGCCC
GCCGGGGCCAGCGCCATTAGTGATTTTTCTCACCATATCGATCTCAGCGTTGAAAAGGCCTGGATGCTGGCGAGCGTCCG
TTACGGCGATAACAAAATTCGCAGCGGCTGGTTGCTGCTGGCCTTGTTGACCACGCCAGAACTGCGTCGGGTACTGAGCA
GTATCTGCGCGCCGCTGGCCACGCTTCCGGTTGATGAACTGACGGAAATACTGCCCTCGTTGATCGAAACATCGCCGGAA
GCGCAGGAGCGCCCTTACGACGGCTCCGGCCTGGCATCAGCCATTCCCGGTGAAAGCAGTCAGGCGATTCCCAACGGCGG
GCAGGACGGTAAATCCGCGCTGGCAAAATACTGTCAGGACATGACGGCACAGGCGCGCGACGGCAAAATCGACCCGGTGA
CGGGGCGTGAGCATGAAATCCGCACCATGACGGATATTCTGCTGCGCCGTCGCCAGAATAATCCACTACTGACTGGTGAG
GCGGGCGTCGGGAAAACGGCGGTCGTCGAAGGTTTTGCCCTCGCGATTGCGCAGGGGGAAGTGCCGCCCGCGCTGCGGGA
AGTACGGCTACTGGCGCTGGACGTTGGCGCTCTGTTGGCCGGAGCCAGCATGAAAGGCGAGTTTGAATCGCGTCTGAAAG
GGTTACTGGAAGAGGCCGGGCGCTCGCCGCAGCCGGTTATTCTGTTTGTCGATGAAGTTCACACTCTGGTGGGCGCGGGC
GGCGCATCCGGCACGGGCGATGCCGCTAACCTGCTGAAACCGGCGCTGGCGCGCGGCACCCTGCGGACTATCGGCGCCAC
CACCTGGAGCGAATACAAGCGCCATATTGAGAAAGATCCGGCGCTGACCCGTCGTTTTCAGGTGTTGCAGATTGCCGAAC
CGGAAGAGATCCCCGCAATGGAAATGGTGCGTGGTCTGGTGGATACGCTGGAAAAACACCATAACGTACTGATTCTGGAT
GAGGCGGTACGTGCGGCGGTACAGCTTTCTCACCGCTACATTCCCGCCCGGCAGTTGCCGGATAAGGCCATCAGCCTGCT
GGATACCGCCGCGGCCCGCGTGGCGCTGACGCTGCACACGCCGCCTGCCAGCGTACAGTTCCTGCGCCAGCAGCTAAAAG
CGGCGGAAATGGAACGGTCGCTGTTGCAGAAGCAGGAAAAAATGGGGATTCAGTCAGATGAGCGGCGCGATGCGCTGATG
GCGCGAATTTTCTCGCTCAACAATGAACTGACTGCATCCGAATCCCGCTGGCAGCGGGAGCTGGAACTGGTACATACGTT
GCAGGAACTGCGTCTCGCAGAGTCTGATGCTGATGACAAAACCACGCTGCAACAGGCCGAAACGGCGCTAAGGGAGTGGC
AGGGCGACGCGCCGGTGGTGTTCCCGGAAGTCAGCGCGGCGGTTGTCGCGGCGATTGTCGCCGACTGGACCGGTATTCCT
GCTGGGCGCATGGTGAAAGATGAGGCCAGCCAGGTGCTGGAACTGCCTGCCCGACTGGCGCAACGCGTTACCGGGCAAGA
CGGCGCGCTGGCGCAGATTGGTGAACGTATTCAGACCGCCAGGGCGGGACTGGGCGATCCACGCAAACCGGTGGGCGTGT
TTATGCTGGCCGGGCCGTCCGGTGTCGGTAAAACCGAAACCGCGCTGGCGCTGGCGGAGGCTATCTACGGCGGCGAGCAG
AACCTGGTAACCATCAATATGAGCGAGTTCCAGGAGGCTCACACCGTTTCCACGCTGAAAGGCGCGCCGCCCGGCTATGT
GGGCTATGGCGAGGGTGGTGTGCTGACGGAAGCGGTGCGTCGCCACCCCTGGAGCGTAGTGCTGCTCGACGAGATCGAAA
AAGCGCACCATGACGTCCACGAACTCTTCTATCAGGTGTTTGACAAGGGTGGGATGGAGGACGGCGAGGGTACACATGTC
GATTTCAAAAACACCACGCTATTACTCACCACCAACGTGGGTTCCGACCTCATCAGCCAGATGTGTGAAGATCCGGCCTT
AATGCCCGATGCTACGGGGCTTAAAGAGGCGCTAATGCCGGAATTGCGCAAGCATTTCCCGGCGGCATTTCTGGGCCGCG
TGACGGTGATCCCTTACCTGCCGCTGGACGAAACGTCGCGTGGCGTGATTGCCCGTCTGCACCTTGACCGGCTGGTGGCG
CGGATGAGTGAACAGCACGGCGTGACGCTGACGTATAGCGAGGAACTGGTCGCACATATTGTGGCGTGCTGTCCAATGCA
TGAAACGGGCGCGCGGTTGCTGATTGGCTACATCGAACAGCACATTCTGCCACGACTGTCGCGCTACTGGTTGCAGGCCA
TGACGGAAAAAGCCGCGATCAGGCAGATTGATATCGGCGTTAATGGTGATGAGCAGATTGTTTTTGAGATCGTTTGCTGA

Protein sequence :
METPVSRSALYGKLAGPLFRSLESATAFCKLRSNPWVELTHWLHQLTQQPDNDILHVLRHYQIPLSDVEKALLRQLDMLP
AGASAISDFSHHIDLSVEKAWMLASVRYGDNKIRSGWLLLALLTTPELRRVLSSICAPLATLPVDELTEILPSLIETSPE
AQERPYDGSGLASAIPGESSQAIPNGGQDGKSALAKYCQDMTAQARDGKIDPVTGREHEIRTMTDILLRRRQNNPLLTGE
AGVGKTAVVEGFALAIAQGEVPPALREVRLLALDVGALLAGASMKGEFESRLKGLLEEAGRSPQPVILFVDEVHTLVGAG
GASGTGDAANLLKPALARGTLRTIGATTWSEYKRHIEKDPALTRRFQVLQIAEPEEIPAMEMVRGLVDTLEKHHNVLILD
EAVRAAVQLSHRYIPARQLPDKAISLLDTAAARVALTLHTPPASVQFLRQQLKAAEMERSLLQKQEKMGIQSDERRDALM
ARIFSLNNELTASESRWQRELELVHTLQELRLAESDADDKTTLQQAETALREWQGDAPVVFPEVSAAVVAAIVADWTGIP
AGRMVKDEASQVLELPARLAQRVTGQDGALAQIGERIQTARAGLGDPRKPVGVFMLAGPSGVGKTETALALAEAIYGGEQ
NLVTINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRHPWSVVLLDEIEKAHHDVHELFYQVFDKGGMEDGEGTHV
DFKNTTLLLTTNVGSDLISQMCEDPALMPDATGLKEALMPELRKHFPAAFLGRVTVIPYLPLDETSRGVIARLHLDRLVA
RMSEQHGVTLTYSEELVAHIVACCPMHETGARLLIGYIEQHILPRLSRYWLQAMTEKAAIRQIDIGVNGDEQIVFEIVC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
STY0294 NP_454876.1 ClpB-like protein Not tested SPI-6 Protein 0.0 99
aec27 AAQ96721.1 Aec27 Not tested AGI-1 Protein 7e-114 42
aec27 YP_851418.1 ATPase Not tested PAI II APEC-O1 Protein 9e-114 42
clpC YP_005163377.1 ATP-dependent Clp protease ATP-binding subunit Not tested Not named Protein 5e-90 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STMUK_0274 YP_005250834.1 putative chaperone ATPase VFG2076 Protein 0.0 53
STMUK_0274 YP_005250834.1 putative chaperone ATPase VFG2084 Protein 7e-127 42
STMUK_0274 YP_005250834.1 putative chaperone ATPase VFG0079 Protein 1e-89 41