Gene Information

Name : STMMW_02711 (STMMW_02711)
Accession : YP_005231349.1
Strain : Salmonella enterica D23580
Genome accession: NC_016854
Putative virulence/resistance : Virulence
Product : type VI system ATPase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 311180 - 313819 bp
Length : 2640 bp
Strand : +
Note : pfam_scan;Pfam:PF10431; E()=1.2E-9;score=37.8;query 787-867;description=ClpB_D2-small; pfam_scan;Pfam:PF00004; E()=3.4E-8;score=33.2;query 236-349;description=AAA; pfam_scan;Pfam:PF07724; E()=4.7E-56;score=188.8;query 609-776;description=AAA_2

DNA sequence :
ATGGAAACTCCTGTTTCACGCAGTGCGTTGTATGGAAAACTGGCCGGCCCACTATTCCGGTCGCTGGAATCGGCAACGGC
ATTTTGCAAACTACGCTCTAATCCCTGGGTTGAGCTGACTCACTGGCTGCACCAGTTAACACAGCAGCCCGATAACGATA
TTCTCCACGTTCTTCGGCATTACCAGATCCCTCTTTCTGATGTGGAGAAAGCGTTACTCCGGCAACTGGATATGCTGCCC
GCCGGGGCCAGCGCCATTAGTGATTTTTCTCACCATATCGATCTCAGCGTTGAAAAGGCCTGGATGCTGGCGAGCGTCCG
TTACGGCGATAACAAAATTCGCAGCGGCTGGTTGCTGCTGGCCTTGTTGACCACGCCAGAACTGCGTCGGGTACTGAGCA
GTATCTGCGCGCCGCTGGCCACGCTTCCGGTTGATGAACTGACGGAAATACTGCCCTCGTTGATCGAAACATCGCCGGAA
GCGCAGGAGCGCCCTTACGACGGCTCCGGCCTGGCATCAGCCATTCCCGGTGAAAGCAGTCAGGCGATTCCCAACGGCGG
GCAGGACGGTAAATCCGCGCTGGCAAAATACTGTCAGGACATGACGGCACAGGCGCGCGACGGCAAAATCGACCCGGTGA
CGGGGCGTGAGCATGAAATCCGCACCATGACGGATATTCTGCTGCGCCGTCGCCAGAATAATCCACTACTGACTGGTGAG
GCGGGCGTCGGGAAAACGGCGGTCGTCGAAGGTTTTGCCCTCGCGATTGCGCAGGGGGAAGTGCCGCCCGCGCTGCGGGA
AGTACGGCTACTGGCGCTGGACGTTGGCGCTCTGTTGGCCGGAGCCAGCATGAAAGGCGAGTTTGAATCGCGTCTGAAAG
GGTTACTGGAAGAGGCCGGGCGCTCGCCGCAGCCGGTTATTCTGTTTGTCGATGAAGTTCACACTCTGGTGGGCGCGGGC
GGCGCATCCGGCACGGGCGATGCCGCTAACCTGCTGAAACCGGCGCTGGCGCGCGGCACCCTGCGGACTATCGGCGCCAC
CACCTGGAGCGAATACAAGCGCCATATTGAGAAAGATCCGGCGCTGACCCGTCGTTTTCAGGTGTTGCAGATTGCCGAAC
CGGAAGAGATCCCCGCAATGGAAATGGTGCGTGGTCTGGTGGATACGCTGGAAAAACACCATAACGTACTGATTCTGGAT
GAGGCGGTACGTGCGGCGGTACAGCTTTCTCACCGCTACATTCCCGCCCGGCAGTTGCCGGATAAGGCCATCAGCCTGCT
GGATACCGCCGCGGCCCGCGTGGCGCTGACGCTGCACACGCCGCCTGCCAGCGTACAGTTCCTGCGCCAGCAGCTAAAAG
CGGCGGAAATGGAACGGTCGCTGTTGCAGAAGCAGGAAAAAATGGGGATTCAGTCAGATGAGCGGCGCGATGCGCTGATG
GCGCGAATTTTCTCGCTCAACAATGAACTGACTGCATCCGAATCCCGCTGGCAGCGGGAGCTGGAACTGGTACATACGTT
GCAGGAACTGCGTCTCGCAGAGTCTGATGCTGATGACAAAACCACGCTGCAACAGGCCGAAACGGCGCTAAGGGAGTGGC
AGGGCGACGCGCCGGTGGTGTTCCCGGAAGTCAGCGCGGCGGTTGTCGCGGCGATTGTCGCCGACTGGACCGGTATTCCT
GCTGGGCGCATGGTGAAAGATGAGGCCAGCCAGGTGCTGGAACTGCCTGCCCGACTGGCGCAACGCGTTACCGGGCAAGA
CGGCGCGCTGGCGCAGATTGGTGAACGTATTCAGACCGCCAGGGCGGGACTGGGCGATCCACGCAAACCGGTGGGCGTGT
TTATGCTGGCCGGGCCGTCCGGTGTCGGTAAAACCGAAACCGCGCTGGCGCTGGCGGAGGCTATCTACGGCGGCGAGCAG
AACCTGGTAACCATCAATATGAGCGAGTTCCAGGAGGCTCACACCGTTTCCACGCTGAAAGGCGCGCCGCCCGGCTATGT
GGGCTATGGCGAGGGTGGTGTGCTGACGGAAGCGGTGCGTCGCCACCCCTGGAGCGTAGTGCTGCTCGACGAGATCGAAA
AAGCGCACCATGACGTCCACGAACTCTTCTATCAGGTGTTTGACAAGGGTGGGATGGAGGACGGCGAGGGTACACATGTC
GATTTCAAAAACACCACGCTATTACTCACCACCAACGTGGGTTCCGACCTCATCAGCCAGATGTGTGAAGATCCGGCCTT
AATGCCCGATGCTACGGGGCTTAAAGAGGCGCTAATGCCGGAATTGCGCAAGCATTTCCCGGCGGCATTTCTGGGCCGCG
TGACGGTGATCCCTTACCTGCCGCTGGACGAAACGTCGCGTGGCGTGATTGCCCGTCTGCACCTTGACCGGCTGGTGGCG
CGGATGAGTGAACAGCACGGCGTGACGCTGACGTATAGCGAGGAACTGGTCGCACATATTGTGGCGTGCTGTCCAATGCA
TGAAACGGGCGCGCGGTTGCTGATTGGCTACATCGAACAGCACATTCTGCCACGACTGTCGCGCTACTGGTTGCAGGCCA
TGACGGAAAAAGCCGCGATCAGGCAGATTGATATCGGCGTTAATGGTGATGAGCAGATTGTTTTTGAGATCGTTTGCTGA

Protein sequence :
METPVSRSALYGKLAGPLFRSLESATAFCKLRSNPWVELTHWLHQLTQQPDNDILHVLRHYQIPLSDVEKALLRQLDMLP
AGASAISDFSHHIDLSVEKAWMLASVRYGDNKIRSGWLLLALLTTPELRRVLSSICAPLATLPVDELTEILPSLIETSPE
AQERPYDGSGLASAIPGESSQAIPNGGQDGKSALAKYCQDMTAQARDGKIDPVTGREHEIRTMTDILLRRRQNNPLLTGE
AGVGKTAVVEGFALAIAQGEVPPALREVRLLALDVGALLAGASMKGEFESRLKGLLEEAGRSPQPVILFVDEVHTLVGAG
GASGTGDAANLLKPALARGTLRTIGATTWSEYKRHIEKDPALTRRFQVLQIAEPEEIPAMEMVRGLVDTLEKHHNVLILD
EAVRAAVQLSHRYIPARQLPDKAISLLDTAAARVALTLHTPPASVQFLRQQLKAAEMERSLLQKQEKMGIQSDERRDALM
ARIFSLNNELTASESRWQRELELVHTLQELRLAESDADDKTTLQQAETALREWQGDAPVVFPEVSAAVVAAIVADWTGIP
AGRMVKDEASQVLELPARLAQRVTGQDGALAQIGERIQTARAGLGDPRKPVGVFMLAGPSGVGKTETALALAEAIYGGEQ
NLVTINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRHPWSVVLLDEIEKAHHDVHELFYQVFDKGGMEDGEGTHV
DFKNTTLLLTTNVGSDLISQMCEDPALMPDATGLKEALMPELRKHFPAAFLGRVTVIPYLPLDETSRGVIARLHLDRLVA
RMSEQHGVTLTYSEELVAHIVACCPMHETGARLLIGYIEQHILPRLSRYWLQAMTEKAAIRQIDIGVNGDEQIVFEIVC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
STY0294 NP_454876.1 ClpB-like protein Not tested SPI-6 Protein 0.0 99
aec27 AAQ96721.1 Aec27 Not tested AGI-1 Protein 7e-114 42
aec27 YP_851418.1 ATPase Not tested PAI II APEC-O1 Protein 9e-114 42
clpC YP_005163377.1 ATP-dependent Clp protease ATP-binding subunit Not tested Not named Protein 5e-90 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STMMW_02711 YP_005231349.1 type VI system ATPase VFG2076 Protein 0.0 53
STMMW_02711 YP_005231349.1 type VI system ATPase VFG2084 Protein 7e-127 42
STMMW_02711 YP_005231349.1 type VI system ATPase VFG0079 Protein 1e-89 41