Gene Information

Name : STMUK_0276 (STMUK_0276)
Accession : YP_005250836.1
Strain : Salmonella enterica UK-1
Genome accession: NC_016863
Putative virulence/resistance : Virulence
Product : putative cytoplasmic protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 314488 - 315981 bp
Length : 1494 bp
Strand : +
Note : -

DNA sequence :
ATGGCAAACAGTAATATGCAGGCAACCGACGCGGTTGCTCAGGATACCGCCTCCGCATCCGGTGAATTTGATGCGTTGCT
GAATCAGGCCTTCCGACCCAAGACTACCCAGGCGGCAAAAGCCGTGGAAGCCGCGGTGCAGACGCTGGCGAACACGATCA
CCGTCAGCGATGACGCCTATAAAAGCATCAGCGCTATTATTGCGCAGATCGACTTTAAACTGACCGAACAGATCAAACTG
ATCCTGCAACATCCCGACTGGCAGAAGCTGGAATCCTCGTGGCGCGGTATGGAGCATCTGGTTTACAACACCGAGACCGA
CGAAAAGCTGAAAATTCGCTTCATGAATCTGTCAAAAGATGAATTGCGGCGCAACATGAAGCGTTACAAGGGCATCGCCT
GGGATCAAAGCCCGATGTTCAAGAAACTGTATGAAGCCGAATACGGCCAGTTAGGTGGCGAACCTTATGGCTGTATCATT
GCGGATTACTACTTCGACCATACACCGCCCGATGTGGATCTGCTTGGCTCTATCGCCAAAGTCGCCGCGTCGGCCCATGC
GCCGTTTATTGCCGGGGCTTCCCCCTCGGTACTGCAAATGGACTCCTGGCAGGAACTGGCGAATCCCCGCGACCTGACCA
AAATCGTCACCCAGAACCTGGAATATGCGCCGTGGAACTCGCTGCGGGCTAGCGAAGACTCCCGTTATATTGGCCTGACG
ATGCCGCGTTTTCTTGCCCGCCTGCCGTATGGCGCAAAAACCAACCCGGTGGACGAGTTTGATTTTGAAGAAGATGCGGA
TGGTTCTGACCATACCAAATACGTCTGGAGCAACGCGGCCTACGCGATGGGCGTAAACATCAACCGTTCCTTCAAACACT
ACGGCTGGTGTACGTTGATTCGCGGTGTGGAATCAGGCGGTGCGGTGGAAAATCTTCCCTGCCATACCTTCCCGACTGAC
GATGGCGGCGTGGACATGAAATGCCCGACCGAAATCGCCATCTCTGACCGCCGCGAGGCTGAACTGGCGAAAAACGGTTT
TATCCCGTTGATCCACCGTAAAAACTCAGACTATGCCGCCTTTATCGGCGCACAGTCGCTGCAAAAACCACAGGAATACT
ACGATCCGGACGCGACGGCCAACGCTAACCTGTCTGCCCGTCTACCGTACCTGTTCGCCTGCTCGCGCTTCGCTCACTTC
CTCAAATGTATCGTCCGCGACAAAATCGGTTCCTTTAAAGAGCGTGAGGATATGCAGCGCTGGCTAAATGAATGGATTAT
GAATTATGTCGACGCCGATCCGGTGAACTCCTCGCAAGAAACTAAAGCCCGTCGTCCGCTGGCTGCCGCTGAAGTAGTGG
TGGAAGAGGTCGAAGGCAATCCAGGTTATTACGACGCGAAATTCTTCCTGCGTCCGCATTTCCAGCTTGAAGGGCTGACG
GGATCGCTGCGCCTGGTGACAAAACTGCCGTCAGTGAAGCAGGGCAATGCCTGA

Protein sequence :
MANSNMQATDAVAQDTASASGEFDALLNQAFRPKTTQAAKAVEAAVQTLANTITVSDDAYKSISAIIAQIDFKLTEQIKL
ILQHPDWQKLESSWRGMEHLVYNTETDEKLKIRFMNLSKDELRRNMKRYKGIAWDQSPMFKKLYEAEYGQLGGEPYGCII
ADYYFDHTPPDVDLLGSIAKVAASAHAPFIAGASPSVLQMDSWQELANPRDLTKIVTQNLEYAPWNSLRASEDSRYIGLT
MPRFLARLPYGAKTNPVDEFDFEEDADGSDHTKYVWSNAAYAMGVNINRSFKHYGWCTLIRGVESGGAVENLPCHTFPTD
DGGVDMKCPTEIAISDRREAELAKNGFIPLIHRKNSDYAAFIGAQSLQKPQEYYDPDATANANLSARLPYLFACSRFAHF
LKCIVRDKIGSFKEREDMQRWLNEWIMNYVDADPVNSSQETKARRPLAAAEVVVEEVEGNPGYYDAKFFLRPHFQLEGLT
GSLRLVTKLPSVKQGNA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec18 AAQ96712.1 Aec18 Not tested AGI-1 Protein 7e-79 42
aec18 YP_851426.1 hypothetical protein Not tested PAI II APEC-O1 Protein 9e-79 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STMUK_0276 YP_005250836.1 putative cytoplasmic protein VFG2070 Protein 2e-174 72
STMUK_0276 YP_005250836.1 putative cytoplasmic protein VFG2475 Protein 3e-82 45
STMUK_0276 YP_005250836.1 putative cytoplasmic protein VFG2093 Protein 2e-82 42