Gene Information

Name : Tthe_2686 (Tthe_2686)
Accession : YP_003853219.1
Strain : Thermoanaerobacterium thermosaccharolyticum DSM 571
Genome accession: NC_014410
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2711921 - 2712619 bp
Length : 699 bp
Strand : -
Note : KEGG: tte:TTE2689 response regulator; PFAM: response regulator receiver; transcriptional regulator; SMART: response regulator receiver

DNA sequence :
TTGAGTAGCAGGATACTAATAATTGACGATGAAAAACCTATTGTAGAGATTTTGAAGTACAATTTAGAAAAAAATGGTTA
CAGTACAATTGAAGCGTATGACGGGGAGGAAGGTCTTAAATTAGCGCAAGAGAAAAATCCTGACCTTATCCTCCTTGATG
TCATGCTTCCAAAGATGGATGGTTTTACTGTTTTGAGAATATTAAGGCAGACAATGACGACGCCTATTTTAATGCTGACG
GCCAAAGAAGAAGAAGTAGACAAAGTGTTGGGATTAGAATTAGGCGCCGATGACTATGTGACAAAGCCATTTTCCATGAG
GGAGCTTATTGCACGGGTGAAAGCTAACCTGAGGCGAAGTGGAATAAACAATGGAGAGGGCATGTCTAATGTCATAATCG
TTAATAATTTAAGCATAGATTTATCAAAGTATAAAGTTGAAAAAAATGGAAGACCTATAGAGCTGACATCAAGGGAATTT
GACCTTTTAAAATTCCTAGTGGCCAACCGAGGGCTCATTTTTTCAAGAGAAATGCTTTTGGAAAAGGTGTGGGGCTATGA
ATATTTTGGCGATGTGAGGACAGTTGATGTGACTATAAGGCGATTGAGGGAAAAAATCGAAGATGATCCAGCAAACCCAA
GGTATATACATACCAAAAGAGGGGTTGGTTATTATTTTAGCGAAGAAAGTGAACTATAA

Protein sequence :
MSSRILIIDDEKPIVEILKYNLEKNGYSTIEAYDGEEGLKLAQEKNPDLILLDVMLPKMDGFTVLRILRQTMTTPILMLT
AKEEEVDKVLGLELGADDYVTKPFSMRELIARVKANLRRSGINNGEGMSNVIIVNNLSIDLSKYKVEKNGRPIELTSREF
DLLKFLVANRGLIFSREMLLEKVWGYEYFGDVRTVDVTIRRLREKIEDDPANPRYIHTKRGVGYYFSEESEL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-37 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-37 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tthe_2686 YP_003853219.1 transcriptional regulator NC_012469.1.7685629. Protein 3e-60 54
Tthe_2686 YP_003853219.1 transcriptional regulator NC_002952.2859905.p0 Protein 3e-53 51
Tthe_2686 YP_003853219.1 transcriptional regulator NC_013450.8614421.p0 Protein 5e-53 51
Tthe_2686 YP_003853219.1 transcriptional regulator NC_007793.3914279.p0 Protein 5e-53 51
Tthe_2686 YP_003853219.1 transcriptional regulator NC_003923.1003749.p0 Protein 5e-53 51
Tthe_2686 YP_003853219.1 transcriptional regulator NC_007622.3794472.p0 Protein 3e-53 51
Tthe_2686 YP_003853219.1 transcriptional regulator NC_002745.1124361.p0 Protein 5e-53 51
Tthe_2686 YP_003853219.1 transcriptional regulator NC_009782.5559369.p0 Protein 5e-53 51
Tthe_2686 YP_003853219.1 transcriptional regulator NC_002951.3237708.p0 Protein 5e-53 51
Tthe_2686 YP_003853219.1 transcriptional regulator NC_002758.1121668.p0 Protein 5e-53 51
Tthe_2686 YP_003853219.1 transcriptional regulator NC_009641.5332272.p0 Protein 5e-53 51
Tthe_2686 YP_003853219.1 transcriptional regulator HE999704.1.gene2815. Protein 4e-52 50
Tthe_2686 YP_003853219.1 transcriptional regulator NC_012469.1.7686381. Protein 5e-47 47
Tthe_2686 YP_003853219.1 transcriptional regulator AE016830.1.gene1681. Protein 9e-48 46
Tthe_2686 YP_003853219.1 transcriptional regulator AE000516.2.gene3505. Protein 2e-42 46
Tthe_2686 YP_003853219.1 transcriptional regulator BAC0197 Protein 4e-38 45
Tthe_2686 YP_003853219.1 transcriptional regulator NC_014475.1.orf0.gen Protein 1e-41 44
Tthe_2686 YP_003853219.1 transcriptional regulator NC_005054.2598277.p0 Protein 1e-41 44
Tthe_2686 YP_003853219.1 transcriptional regulator NC_002951.3238224.p0 Protein 4e-36 43
Tthe_2686 YP_003853219.1 transcriptional regulator NC_007793.3914065.p0 Protein 4e-36 43
Tthe_2686 YP_003853219.1 transcriptional regulator NC_002758.1121390.p0 Protein 4e-36 43
Tthe_2686 YP_003853219.1 transcriptional regulator NC_010079.5776364.p0 Protein 4e-36 43
Tthe_2686 YP_003853219.1 transcriptional regulator NC_002952.2859858.p0 Protein 4e-36 43
Tthe_2686 YP_003853219.1 transcriptional regulator NC_007622.3794948.p0 Protein 4e-36 43
Tthe_2686 YP_003853219.1 transcriptional regulator NC_003923.1003417.p0 Protein 4e-36 43
Tthe_2686 YP_003853219.1 transcriptional regulator NC_013450.8614146.p0 Protein 4e-36 43
Tthe_2686 YP_003853219.1 transcriptional regulator CP000675.2.gene1535. Protein 7e-40 43
Tthe_2686 YP_003853219.1 transcriptional regulator BAC0125 Protein 5e-39 43
Tthe_2686 YP_003853219.1 transcriptional regulator HE999704.1.gene1528. Protein 3e-35 43
Tthe_2686 YP_003853219.1 transcriptional regulator AF155139.2.orf0.gene Protein 1e-38 43
Tthe_2686 YP_003853219.1 transcriptional regulator AE015929.1.gene1106. Protein 7e-30 42
Tthe_2686 YP_003853219.1 transcriptional regulator CP001485.1.gene721.p Protein 3e-34 42
Tthe_2686 YP_003853219.1 transcriptional regulator DQ212986.1.gene4.p01 Protein 2e-40 42
Tthe_2686 YP_003853219.1 transcriptional regulator FJ349556.1.orf0.gene Protein 2e-39 42
Tthe_2686 YP_003853219.1 transcriptional regulator CP000034.1.gene3834. Protein 4e-30 42
Tthe_2686 YP_003853219.1 transcriptional regulator NC_002695.1.915041.p Protein 4e-30 42
Tthe_2686 YP_003853219.1 transcriptional regulator CP001918.1.gene5135. Protein 2e-25 42
Tthe_2686 YP_003853219.1 transcriptional regulator AM180355.1.gene1830. Protein 4e-39 41
Tthe_2686 YP_003853219.1 transcriptional regulator AF162694.1.orf4.gene Protein 5e-37 41
Tthe_2686 YP_003853219.1 transcriptional regulator EU250284.1.orf4.gene Protein 1e-38 41
Tthe_2686 YP_003853219.1 transcriptional regulator BAC0308 Protein 4e-35 41
Tthe_2686 YP_003853219.1 transcriptional regulator BAC0111 Protein 1e-35 41
Tthe_2686 YP_003853219.1 transcriptional regulator CP000647.1.gene4257. Protein 5e-30 41
Tthe_2686 YP_003853219.1 transcriptional regulator CP001138.1.gene4273. Protein 3e-30 41
Tthe_2686 YP_003853219.1 transcriptional regulator BAC0533 Protein 5e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tthe_2686 YP_003853219.1 transcriptional regulator VFG1389 Protein 8e-35 44
Tthe_2686 YP_003853219.1 transcriptional regulator VFG0596 Protein 5e-38 43
Tthe_2686 YP_003853219.1 transcriptional regulator VFG1386 Protein 4e-41 43
Tthe_2686 YP_003853219.1 transcriptional regulator VFG1390 Protein 3e-37 42
Tthe_2686 YP_003853219.1 transcriptional regulator VFG1563 Protein 6e-39 41