Gene Information

Name : GNIT_2765 (GNIT_2765)
Accession : YP_004872855.1
Strain : Glaciecola nitratireducens FR1064
Genome accession: NC_016041
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3061621 - 3062304 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence :
ATGAAAATACTGATAATAGAAGACGACTTGACCGTTGCTGGTTATATCTCCAAGGGTCTTGAAGAATCTGGCCATACCCC
TGACGTTGCAAATGACGGCAAGCAAGGGCTACTCCTAGCCACAACGAATAGCTATGACGTTATTGTCCTCGACAGAATGT
TGCCGCATATCGACGGCATTACTATCCTGAATACCATAAGAGACTCGGGAGACAATACCCCAGCGGTTATTCTTAGCGCA
AAAAACAAAGTGGAAGATAAAGTGAAAGGTCTACGCTCAGGCGCCGCCGATTATATGACAAAACCTTTTGCTTTTGAGGA
GCTTTTAGCTCGAATCGAAATTGTAGCTTCTCGTCAATCGGGCGCCGTGCCCTCCGTTACCGAGATCGTATTAGGTGAAC
TAAAGCTCGACCTAATCAACAGGCAAGTAACCCGCAACGGCACGATTATCGATTTGCAGTCAAAAGAATTCAAATTACTT
GAGTACCTATTAAAAAACAAAGGCAAGATTGTCACGAGAACGATGTTGTTAGAAAAAGTGTGGGAATACAATTTCGACCC
GCAAACGAACGTCATTGACGTGCACATCAGTAGATTAAGAAACAAAATAGATAAAGGCTTTAGCTATCCAATTATCGAAA
CTATTCGCGGTGCCGGTTATTTAGTATCCGAACCCAAGACATAG

Protein sequence :
MKILIIEDDLTVAGYISKGLEESGHTPDVANDGKQGLLLATTNSYDVIVLDRMLPHIDGITILNTIRDSGDNTPAVILSA
KNKVEDKVKGLRSGAADYMTKPFAFEELLARIEIVASRQSGAVPSVTEIVLGELKLDLINRQVTRNGTIIDLQSKEFKLL
EYLLKNKGKIVTRTMLLEKVWEYNFDPQTNVIDVHISRLRNKIDKGFSYPIIETIRGAGYLVSEPKT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-41 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-41 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GNIT_2765 YP_004872855.1 two-component response regulator BAC0111 Protein 1e-49 45
GNIT_2765 YP_004872855.1 two-component response regulator BAC0125 Protein 3e-44 44
GNIT_2765 YP_004872855.1 two-component response regulator BAC0638 Protein 2e-42 44
GNIT_2765 YP_004872855.1 two-component response regulator BAC0308 Protein 1e-45 44
GNIT_2765 YP_004872855.1 two-component response regulator BAC0197 Protein 2e-42 44
GNIT_2765 YP_004872855.1 two-component response regulator NC_007793.3914065.p0 Protein 9e-31 42
GNIT_2765 YP_004872855.1 two-component response regulator NC_007622.3794948.p0 Protein 9e-31 42
GNIT_2765 YP_004872855.1 two-component response regulator NC_002951.3238224.p0 Protein 9e-31 42
GNIT_2765 YP_004872855.1 two-component response regulator NC_002952.2859858.p0 Protein 9e-31 42
GNIT_2765 YP_004872855.1 two-component response regulator NC_013450.8614146.p0 Protein 9e-31 42
GNIT_2765 YP_004872855.1 two-component response regulator NC_010079.5776364.p0 Protein 9e-31 42
GNIT_2765 YP_004872855.1 two-component response regulator NC_003923.1003417.p0 Protein 9e-31 42
GNIT_2765 YP_004872855.1 two-component response regulator NC_002758.1121390.p0 Protein 9e-31 42
GNIT_2765 YP_004872855.1 two-component response regulator BAC0347 Protein 3e-45 42
GNIT_2765 YP_004872855.1 two-component response regulator HE999704.1.gene1528. Protein 4e-33 42
GNIT_2765 YP_004872855.1 two-component response regulator AE015929.1.gene1106. Protein 4e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GNIT_2765 YP_004872855.1 two-component response regulator VFG0596 Protein 4e-42 45