Gene Information

Name : STMMW_02741 (STMMW_02741)
Accession : YP_005231351.1
Strain : Salmonella enterica D23580
Genome accession: NC_016854
Putative virulence/resistance : Virulence
Product : type VI system secreted protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 314485 - 315978 bp
Length : 1494 bp
Strand : +
Note : pfam_scan;Pfam:PF05943; E()=2.1E-197;score=655.1;query 63-490;description=DUF877

DNA sequence :
ATGGCAAACAGTAATATGCAGGCAACCGACGCGGTTGCTCAGGATACCGCCTCCGCATCCGGTGAATTTGATGCGTTGCT
GAATCAGGCCTTCCGACCCAAGACTACCCAGGCGGCAAAAGCCGTGGAAGCCGCGGTGCAGACGCTGGCGAACACGATCA
CCGTCAGCGATGACGCCTATAAAAGCATCAGCGCTATTATTGCGCAGATCGACTTTAAACTGACCGAACAGATCAAACTG
ATCCTGCAACATCCCGACTGGCAGAAGCTGGAATCCTCGTGGCGCGGTATGGAGCATCTGGTTTACAACACCGAGACCGA
CGAAAAGCTGAAAATTCGCTTCATGAATCTGTCAAAAGATGAATTGCGGCGCAACATGAAGCGTTACAAGGGCATCGCCT
GGGATCAAAGCCCGATGTTCAAGAAACTGTATGAAGCCGAATACGGCCAGTTAGGTGGCGAACCTTATGGCTGTATCATT
GCGGATTACTACTTCGACCATACACCGCCCGATGTGGATCTGCTTGGCTCTATCGCCAAAGTCGCCGCGTCGGCCCATGC
GCCGTTTATTGCCGGGGCTTCCCCCTCGGTACTGCAAATGGACTCCTGGCAGGAACTGGCGAATCCCCGCGACCTGACCA
AAATCGTCACCCAGAACCTGGAATATGCGCCGTGGAACTCGCTGCGGGCTAGCGAAGACTCCCGTTATATTGGCCTGACG
ATGCCGCGTTTTCTTGCCCGCCTGCCGTATGGCGCAAAAACCAACCCGGTGGACGAGTTTGATTTTGAAGAAGATGCGGA
TGGTTCTGACCATACCAAATACGTCTGGAGCAACGCGGCCTACGCGATGGGCGTAAACATCAACCGTTCCTTCAAACACT
ACGGCTGGTGTACGTTGATTCGCGGTGTGGAATCAGGCGGTGCGGTGGAAAATCTTCCCTGCCATACCTTCCCGACTGAC
GATGGCGGCGTGGACATGAAATGCCCGACCGAAATCGCCATCTCTGACCGCCGCGAGGCTGAACTGGCGAAAAACGGTTT
TATCCCGTTGATCCACCGTAAAAACTCAGACTATGCCGCCTTTATCGGCGCACAGTCGCTGCAAAAACCACAGGAATACT
ACGATCCGGACGCGACGGCCAACGCTAACCTGTCTGCCCGTCTACCGTACCTGTTCGCCTGCTCGCGCTTCGCTCACTTC
CTCAAATGTATCGTCCGCGACAAAATCGGTTCCTTTAAAGAGCGTGAGGATATGCAGCGCTGGCTAAATGAATGGATTAT
GAATTATGTCGACGCCGATCCGGTGAACTCCTCGCAAGAAACTAAAGCCCGTCGTCCGCTGGCTGCCGCTGAAGTAGTGG
TGGAAGAGGTCGAAGGCAATCCAGGTTATTACGACGCGAAATTCTTCCTGCGTCCGCATTTCCAGCTTGAAGGGCTGACG
GGATCGCTGCGCCTGGTGACAAAACTGCCGTCAGTGAAGCAGGGCAATGCCTGA

Protein sequence :
MANSNMQATDAVAQDTASASGEFDALLNQAFRPKTTQAAKAVEAAVQTLANTITVSDDAYKSISAIIAQIDFKLTEQIKL
ILQHPDWQKLESSWRGMEHLVYNTETDEKLKIRFMNLSKDELRRNMKRYKGIAWDQSPMFKKLYEAEYGQLGGEPYGCII
ADYYFDHTPPDVDLLGSIAKVAASAHAPFIAGASPSVLQMDSWQELANPRDLTKIVTQNLEYAPWNSLRASEDSRYIGLT
MPRFLARLPYGAKTNPVDEFDFEEDADGSDHTKYVWSNAAYAMGVNINRSFKHYGWCTLIRGVESGGAVENLPCHTFPTD
DGGVDMKCPTEIAISDRREAELAKNGFIPLIHRKNSDYAAFIGAQSLQKPQEYYDPDATANANLSARLPYLFACSRFAHF
LKCIVRDKIGSFKEREDMQRWLNEWIMNYVDADPVNSSQETKARRPLAAAEVVVEEVEGNPGYYDAKFFLRPHFQLEGLT
GSLRLVTKLPSVKQGNA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec18 AAQ96712.1 Aec18 Not tested AGI-1 Protein 7e-79 42
aec18 YP_851426.1 hypothetical protein Not tested PAI II APEC-O1 Protein 9e-79 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STMMW_02741 YP_005231351.1 type VI system secreted protein VFG2070 Protein 2e-174 72
STMMW_02741 YP_005231351.1 type VI system secreted protein VFG2475 Protein 3e-82 45
STMMW_02741 YP_005231351.1 type VI system secreted protein VFG2093 Protein 2e-82 42