Gene Information

Name : Alide_2741 (Alide_2741)
Accession : YP_004127359.1
Strain : Alicycliphilus denitrificans BC
Genome accession: NC_014910
Putative virulence/resistance : Virulence
Product : heavy metal response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2836085 - 2836768 bp
Length : 684 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; KEGG: dia:Dtpsy_2201 two component heavy metal response transcriptional regulator, winged helix family; SMART: response regula

DNA sequence :
GTGAAGATATTGATCGTCGAAGACGAGCCCAAGACGGGCGAGTATTTGCGCCAGGGCCTGAGCGAGGCCGGGTATGTGGC
GGACCTGGTGCCCAATGGCACCGATGGGCTGCACATGGCCTTGCACGGTGCCTACGACCTCGTGATCCTGGATGTCATGC
TGCCCGGGCTGAACGGCTGGCAGGTGCTGCAATCGCTGCGCGAGCGCGGCCTGCAAATGCCAGTGCTGTTCCTGACCGCA
CGCGACCAGGTGGAAGACCGTGTCAAGGGACTGGAGCTTGGTGCGGACGACTATCTGGTCAAACCGTTCTCGTTTGCGGA
ACTGCTGGCCCGCGTGCGCATCATCTTGCGCCGTGGCCCGGCGGGCAACGAAGGCACCATGTTGCGCGTCGCCGATCTGG
AGCTGGATCTGCTGCGCCGCCGGGTCTCGCGCAACGGCAGGCGCGTGGACCTGACGGCCAAGGAGTTCGGCCTGCTGGAA
CTGCTGATGCGCCGCCATGGCGAGGTGCTGCCGCGCTCCCTGATCGCTTCGCAGGTGTGGGACATGAACTTCGACAGCGA
CACCAACGTCATCGAAGTGGCGATGCGCCGACTGCGCATGAAGATTGACGAGGGCCACGCGGTCAAGCTGATCCAGACCG
TGCGCGGCATGGGCTATGTGCTCGACGTGCCGCAGGAGGAGTAG

Protein sequence :
MKILIVEDEPKTGEYLRQGLSEAGYVADLVPNGTDGLHMALHGAYDLVILDVMLPGLNGWQVLQSLRERGLQMPVLFLTA
RDQVEDRVKGLELGADDYLVKPFSFAELLARVRIILRRGPAGNEGTMLRVADLELDLLRRRVSRNGRRVDLTAKEFGLLE
LLMRRHGEVLPRSLIASQVWDMNFDSDTNVIEVAMRRLRMKIDEGHAVKLIQTVRGMGYVLDVPQEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-57 60
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-56 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alide_2741 YP_004127359.1 heavy metal response regulator BAC0197 Protein 7e-69 70
Alide_2741 YP_004127359.1 heavy metal response regulator BAC0638 Protein 7e-64 69
Alide_2741 YP_004127359.1 heavy metal response regulator BAC0083 Protein 5e-70 68
Alide_2741 YP_004127359.1 heavy metal response regulator BAC0111 Protein 3e-66 64
Alide_2741 YP_004127359.1 heavy metal response regulator BAC0308 Protein 3e-64 64
Alide_2741 YP_004127359.1 heavy metal response regulator BAC0125 Protein 2e-66 63
Alide_2741 YP_004127359.1 heavy metal response regulator BAC0347 Protein 3e-60 61
Alide_2741 YP_004127359.1 heavy metal response regulator NC_007793.3914065.p0 Protein 2e-35 42
Alide_2741 YP_004127359.1 heavy metal response regulator NC_007622.3794948.p0 Protein 2e-35 42
Alide_2741 YP_004127359.1 heavy metal response regulator NC_002951.3238224.p0 Protein 2e-35 42
Alide_2741 YP_004127359.1 heavy metal response regulator NC_002952.2859858.p0 Protein 2e-35 42
Alide_2741 YP_004127359.1 heavy metal response regulator NC_013450.8614146.p0 Protein 2e-35 42
Alide_2741 YP_004127359.1 heavy metal response regulator NC_010079.5776364.p0 Protein 2e-35 42
Alide_2741 YP_004127359.1 heavy metal response regulator NC_003923.1003417.p0 Protein 2e-35 42
Alide_2741 YP_004127359.1 heavy metal response regulator NC_002758.1121390.p0 Protein 2e-35 42
Alide_2741 YP_004127359.1 heavy metal response regulator HE999704.1.gene1528. Protein 1e-27 42
Alide_2741 YP_004127359.1 heavy metal response regulator NC_002516.2.879194.p Protein 1e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alide_2741 YP_004127359.1 heavy metal response regulator VFG0596 Protein 3e-57 60
Alide_2741 YP_004127359.1 heavy metal response regulator VFG1390 Protein 9e-40 46
Alide_2741 YP_004127359.1 heavy metal response regulator VFG1386 Protein 2e-36 43
Alide_2741 YP_004127359.1 heavy metal response regulator VFG1389 Protein 2e-33 43